KEGG   Pseudoalteromonas atlantica: Patl_2176Help
Entry
Patl_2176         CDS       T00372                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Patl_2176
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Patl_2176
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Patl_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2627298..2627729
Genome map
AA seq 143 aa AA seqDB search
MDIYHGKVLLIVNTASKCGFTPQYDGLQSLQETYATQGFEVLGFPCDQFGHQEPGNDEEI
EQFCTTHFSVSFPLFAKVEVNGINAHPLFMYLKKHAPGIFGSTRIKWNFTKFLVDSHGNV
VKRYSPKTKPEQIKKDIEALLSA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggatatatatcacggtaaggtgctcttgattgtgaatacagcaagtaagtgtggattt
acgccgcaatatgatggattgcaatcattgcaggaaacctatgccacgcaagggttcgag
gtgctgggctttccgtgtgatcaatttgggcatcaagagccaggtaatgatgaggaaatt
gaacaattttgtacaactcatttttctgtttcttttccgctatttgccaaggttgaagtg
aatggcattaatgcacaccccttattcatgtacttaaagaaacatgccccaggtattttt
ggatcgacccgcatcaaatggaatttcaccaaattcttagtcgattcacacggtaacgtg
gttaagcgctattcgcctaaaaccaagccggaacagattaaaaaggacattgaagcgcta
ttaagcgcataa

DBGET integrated database retrieval system