KEGG   Pseudoalteromonas atlantica: Patl_2526Help
Entry
Patl_2526         CDS       T00372                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00480  Glutathione metabolism
pat00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Patl_2526
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Patl_2526
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Patl_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABG41042
UniProt: Q15SU6
Position
3062452..3062994
Genome map
AA seq 180 aa AA seqDB search
MKKLLAITCLMFFCNMAYSAQCPDLLKFVKRKLNSQDTVNLCETYAGKTVLFVNTASYCG
FTPQFKGLEALYSKYKDQGLVVLGFPSHDFNQEDKDESKTAELCELTYGVEFPMFEAMPV
RGRDADQLYRMLAKKSGTTVKWNFYKYLMDKNGNLVNAYASSTKPTDPAFIETVENTLKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttacttgctattacctgcctaatgttcttttgtaacatggcttacagtgca
caatgccctgatttattaaagtttgttaagcgtaaactcaactctcaagacacggtcaat
ctgtgtgaaacctatgcaggcaaaacggtactcttcgttaacaccgcgagttactgtggt
tttaccccgcaatttaagggcttagaggcgctatacagtaaatacaaagatcaaggtttg
gtggttttgggctttccgtcacatgatttcaatcaagaagacaaagatgaaagcaaaaca
gctgagctttgcgagctcacatacggtgtcgaatttcctatgttcgaagccatgcctgtg
cgcgggcgtgatgctgaccaactctatcgtatgctggcgaagaagtctggcacgaccgtt
aagtggaacttctataaatacttgatggataaaaacggtaatttggtcaacgcctacgcc
tcatcaaccaagccgacagatccagcatttattgaaaccgtggaaaataccttaaaacga
taa

DBGET integrated database retrieval system