KEGG   Pseudoalteromonas atlantica: Patl_2554Help
Entry
Patl_2554         CDS       T00372                                 

Definition
dethiobiotin synthase
Orthology
K01935  
dethiobiotin synthetase [EC:6.3.3.3]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Patl_2554
Enzymes [BR:pat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     Patl_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3097836..3098699)
Genome map
AA seq 287 aa AA seqDB search
MSLDSPSTNQRHLKSHQQSISKNALQQGSSEYTPAEQTPSDQRPLKESKQHAFFVTGTDT
EVGKTFVSCALLAACHDAGLSTAAYKPVSAGCDVTQAGLRNEDALALQQASNTPLSYDEV
NPIAFAEPIAPHLACEKLMTKGQGAPIELDTINEGYVALIEKKSDMLLVEGAGGWRLPLG
QNSQGQEQFLSDFAISQKLPVILVVGMRLGCINHALLTAQSIEQDGLNVAGWVANMLEPE
MPFLEENIHSLARLLNAPLIARVPRAESPIAVKARINLSLLGVKKPD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagactcacccagcactaatcaacgccaccttaaaagtcatcagcaaagcatc
agcaaaaatgccttacaacaaggctcttcagagtatacgcctgcggagcaaacgccctca
gatcaaaggcccttaaaagaaagtaagcaacatgcttttttcgtgacaggcactgacact
gaagtgggcaaaacctttgttagctgtgcgttactagcagcgtgtcatgacgctggctta
tcaacagcggcatataaacccgtatccgctggttgcgacgtgacccaggcgggccttaga
aatgaagatgcactggcgttacaacaagccagtaataccccacttagctacgatgaagta
aacccaattgcgtttgcagagcctatcgcgccgcatttagcctgcgaaaagttaatgact
aaaggccagggggctcccattgagttagataccataaacgaaggctacgtagccttaata
gagaaaaaaagcgatatgcttttggtagaaggcgcgggcggttggcgtttaccccttggt
caaaatagtcagggccaagaacagtttttatctgactttgccattagccaaaaactgcca
gtgatcttagttgttggtatgcggttaggctgtattaatcacgcgttgttaacagcacaa
tcaatagagcaggacggtcttaatgttgctggttgggtcgctaatatgcttgagccagaa
atgccatttttggaagagaacatccacagtctggcgcgtttacttaatgcacccttgatc
gcgcgagtgccacgcgcagaaagccccatagccgtgaaagcacgcattaatttatcattg
ctgggggtaaaaaagcctgactga

DBGET integrated database retrieval system