KEGG   Pseudoalteromonas atlantica: Patl_2554Help
Entry
Patl_2554         CDS       T00372                                 

Definition
dethiobiotin synthase
Orthology
K01935  
dethiobiotin synthetase [EC:6.3.3.3]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Class
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:pat00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3097836..3098699)
Genome map
AA seq 287 aa AA seqDB search
MSLDSPSTNQRHLKSHQQSISKNALQQGSSEYTPAEQTPSDQRPLKESKQHAFFVTGTDT
EVGKTFVSCALLAACHDAGLSTAAYKPVSAGCDVTQAGLRNEDALALQQASNTPLSYDEV
NPIAFAEPIAPHLACEKLMTKGQGAPIELDTINEGYVALIEKKSDMLLVEGAGGWRLPLG
QNSQGQEQFLSDFAISQKLPVILVVGMRLGCINHALLTAQSIEQDGLNVAGWVANMLEPE
MPFLEENIHSLARLLNAPLIARVPRAESPIAVKARINLSLLGVKKPD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagactcacccagcactaatcaacgccaccttaaaagtcatcagcaaagcatc
agcaaaaatgccttacaacaaggctcttcagagtatacgcctgcggagcaaacgccctca
gatcaaaggcccttaaaagaaagtaagcaacatgcttttttcgtgacaggcactgacact
gaagtgggcaaaacctttgttagctgtgcgttactagcagcgtgtcatgacgctggctta
tcaacagcggcatataaacccgtatccgctggttgcgacgtgacccaggcgggccttaga
aatgaagatgcactggcgttacaacaagccagtaataccccacttagctacgatgaagta
aacccaattgcgtttgcagagcctatcgcgccgcatttagcctgcgaaaagttaatgact
aaaggccagggggctcccattgagttagataccataaacgaaggctacgtagccttaata
gagaaaaaaagcgatatgcttttggtagaaggcgcgggcggttggcgtttaccccttggt
caaaatagtcagggccaagaacagtttttatctgactttgccattagccaaaaactgcca
gtgatcttagttgttggtatgcggttaggctgtattaatcacgcgttgttaacagcacaa
tcaatagagcaggacggtcttaatgttgctggttgggtcgctaatatgcttgagccagaa
atgccatttttggaagagaacatccacagtctggcgcgtttacttaatgcacccttgatc
gcgcgagtgccacgcgcagaaagccccatagccgtgaaagcacgcattaatttatcattg
ctgggggtaaaaaagcctgactga

DBGET integrated database retrieval system