KEGG   Pseudoalteromonas atlantica: Patl_2592Help
Entry
Patl_2592         CDS       T00372                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00010  Glycolysis / Gluconeogenesis
pat00030  Pentose phosphate pathway
pat00051  Fructose and mannose metabolism
pat00052  Galactose metabolism
pat00680  Methane metabolism
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01120  Microbial metabolism in diverse environments
pat01130  Biosynthesis of antibiotics
pat01200  Carbon metabolism
pat01230  Biosynthesis of amino acids
pat03018  RNA degradation
Module
pat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_2592
   00030 Pentose phosphate pathway
    Patl_2592
   00051 Fructose and mannose metabolism
    Patl_2592
   00052 Galactose metabolism
    Patl_2592
  Energy metabolism
   00680 Methane metabolism
    Patl_2592
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Patl_2592
Enzymes [BR:pat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Patl_2592
Protein phosphatases and associated proteins [BR:pat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Patl_2592
Messenger RNA biogenesis [BR:pat03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Patl_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Glyco_transf_43 ComC
Motif
Other DBs
NCBI-ProteinID: ABG41107
UniProt: Q15SN1
Position
complement(3146680..3147651)
Genome map
AA seq 323 aa AA seqDB search
MTKDIKHIGLFTSGGDAPGMNAALYAVVKAASANGIKVSGIRKGFEGLIDNDFVELKTKQ
LQKTMHLGGTVLKTARSERFRTAEGREVALQNIHDNKIDGLIAIGGDGTFRGISLLSQIS
DIPCIGIPGTIDNDTVGTDFTLGFDSAVNTAMNCIDNIRDTAESHNRMFVIEVMGRDSGY
IGVFSGLTSGADSILIPESPQDMTYLLDKIQGYESEDAFIVVLSEGNELSIDRVSQQIRQ
VNDSIDLRVCKLGHIQRGGNPTAADRMLGIRLGVVAVNALIQGESNQMAGICNNQPVLTP
FSEIAKQHTIDSEQQRLVDLFCR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagatattaagcatattggcttatttacctcaggcggcgatgcccctggtatg
aatgccgctttgtatgcagtggtaaaagcggctagcgccaatggcattaaagtcagcggg
atacgcaaagggtttgaagggctgattgataacgatttcgtggagctgaagactaagcag
ttacaaaaaacgatgcatctgggcggtaccgtgcttaaaactgcgcgaagcgagcgcttt
agaacggctgaagggcgagaagtggcgttacagaatatccacgataataaaatcgacggg
ctcatcgcgattggcggagatggcacttttcgtggcatttcgctgttgtcacagataagt
gacattccatgtattggtatcccaggcaccatagataatgacacggtaggcactgacttt
accttggggttcgattctgcggtcaatacggcgatgaactgtattgataatatacgggac
accgcagagtctcataacagaatgtttgttattgaagtcatgggcagagattccggctat
ataggggtgttttcaggcttaacatcaggggctgactcgatcctaatcccagaaagcccg
caggatatgacgtacctgctagataaaattcagggttacgaaagtgaagatgcgtttatt
gtggtgttgtcagaaggcaacgagttgagcatcgaccgagtgtcacagcagatacgtcaa
gtgaacgactcaatagacttacgtgtgtgcaaactgggccacattcaaagaggaggcaac
cctacagcagcagacagaatgttaggcataaggctaggcgtggtggcagtaaatgccctt
atccaaggggaaagcaaccagatggcgggtatttgcaataatcagcctgtactgacgcca
ttttctgaaatagccaagcaacacaccatcgattcggagcaacaacgtctagtggatttg
ttttgccgttaa

DBGET integrated database retrieval system