KEGG   Pseudoalteromonas atlantica: Patl_2593Help
Entry
Patl_2593         CDS       T00372                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Patl_2593
   01230 Biosynthesis of amino acids
    Patl_2593
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Patl_2593
  Energy metabolism
   00680 Methane metabolism
    Patl_2593
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Patl_2593
Enzymes [BR:pat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Patl_2593
Exosome [BR:pat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Patl_2593
  Exosomal proteins of melanoma cells
   Patl_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3147691..3148374)
Genome map
AA seq 227 aa AA seqDB search
MSLLTLIRHGQSIWNQQNRFTGWVDVSLSQSGVKEAQRAAQMLSQQRFDLAFTSELLRAQ
DTLYEILRHNRQCHQYVRIHDTGSQWYEHFEASPAEELELRIYVSQQLNERYYGDLQGLN
KDKARQLFGDEQVHTWRRSYNVAPPNGESLAMTATRAIAYFQSHIVPALQQGKNVLVCAH
GNSLRAIIMHIEKMTAAQIAAYELKTASPHIYQCNTAMDILSKQVLE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttattaaccttgatacgccatgggcaatccatttggaatcagcaaaatcggttc
accggatgggtggatgtttcgcttagccagtcaggggtaaaagaagcgcagcgagccgca
caaatgttatcccagcagcgctttgatctagcattcacctctgagctattgcgggcgcaa
gacactctatatgagatacttcggcataatcgccaatgtcaccaatacgtgcgtattcat
gatactggtagtcagtggtatgagcattttgaagcgtctcccgctgaggaacttgagctg
agaatttacgtttcacagcaactgaatgagcgctattacggcgacctacaggggctgaac
aaagacaaggcgcggcagttgttcggtgatgaacaggttcatacttggcggcgaagttat
aatgtcgcaccgcccaatggcgaaagtctcgcgatgaccgccactcgcgcgatcgcttac
tttcaatcgcatattgttccggctctacagcaaggcaagaatgtgttggtttgtgctcac
ggtaattcgttgcgcgccattattatgcacattgaaaaaatgaccgccgcgcagattgct
gcatatgaattaaaaactgctagccctcatatttatcagtgcaatacagcaatggacata
ctcagtaagcaggtgcttgagtaa

DBGET integrated database retrieval system