KEGG   Pseudoalteromonas atlantica: Patl_2657Help
Entry
Patl_2657         CDS       T00372                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pat  Pseudoalteromonas atlantica
Brite
Enzymes [BR:pat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Patl_2657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3222537..3223808
Genome map
AA seq 423 aa AA seqDB search
MLRKFMLRGRLRKELILKLNLLKPNMLTMKPCLLALALAATSTVSQVATAVSSNDSALSL
KNEAVNPKNEAVSQTKSLKAHFSKQFLVGSAINAQQAKRTEQDTDALIITQFNTITPENE
LKWERIHPKPDAYDFSLSDEYVDFGLANNMFIIGHTLVWHSQTPDWVFEDVQGELLTREA
LLARMKEHIHTVVSRYKGKIKGWDVVNEALNEDGSLRDSKWRQIIGDDFIEKAFTYAHAA
DPDAKLYYNDYNLYKPEKSAGAAKLIKSLQDKGIPVHGVGLQGHYSLTHPALNELDDALT
LFASLGIESMITELDVSVLPFPSEAEQGADISQDLSLNKALNPYPDGLPEAQQDALSARY
KEIFSVFLTHQDTLTRVTFWGVNDAHSWRNNWPMRGRTDYPLLFDRNSEIKPAYRAVMTL
TID
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaaagttcatgctaagagggcgtttgaggaaagaattgatactcaagttaaac
ctgcttaaacccaacatgctaacgatgaaaccttgcttgttggcactcgcgttagcggcg
acatccactgtaagccaggtagctacagccgtgagctcaaatgactcagccttgagcctt
aaaaatgaggcagtgaatcctaaaaacgaggctgtgagccaaacaaaaagtctgaaagcc
catttcagtaaacagtttttagtgggcagtgctattaacgcacagcaagctaaacgcacc
gaacaagacactgatgccttaatcatcacccaatttaatacgattacccctgaaaacgaa
ttaaagtgggagcgcattcatccaaagcctgatgcctatgacttctctctgtccgatgag
tacgtggatttcggcttagccaataatatgttcattatagggcacacgttggtttggcac
agccaaacaccggattgggtatttgaagacgtacaaggtgagttgttaacgagagaggcg
ttgttagctcgcatgaaagagcacattcacaccgttgtgagtcgctacaaaggcaaaatc
aaaggctgggacgtggtcaatgaagcgctcaatgaagatggtagcctgcgggattctaag
tggcggcagattattggcgatgacttcattgaaaaagcctttacctatgcccacgctgca
gatccagatgctaaattgtattacaacgattacaacttatataaaccagaaaaaagtgcc
ggtgcagcaaaactaatcaagtcattacaagacaaagggatccctgttcacggtgtcggc
ttgcaaggccactactcgttaacgcaccctgccttaaatgaattagacgatgcgttaacg
ctgtttgcttccttggggattgaatccatgatcaccgagttagatgtatccgtattaccc
tttcccagtgaagctgaacaaggggcagatatcagccaagatttatccttgaacaaagcc
ttaaatccctatcctgatgggttaccagaagcgcagcaggacgcattaagtgctcgatac
aaggagatattttcggtatttctaacgcaccaagacacgctaacacgcgttacgttttgg
ggcgtgaatgatgcccacagttggcgtaacaactggccaatgcgcgggcgcaccgattac
ccattactgtttgatcgaaacagtgaaattaagcccgcctatcgtgctgtcatgacacta
actattgactga

DBGET integrated database retrieval system