KEGG   Pseudoalteromonas atlantica: Patl_2833Help
Entry
Patl_2833         CDS       T00372                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Patl_2833
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Patl_2833
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Patl_2833
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Patl_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3435165..3436352
Genome map
AA seq 395 aa AA seqDB search
MNHLESKFGQFGGMYVPELLIPALDQLEQAFIDAQNDPEFQKEFMELLTDYAGRPTAMTL
SRNLVSNPNVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQAPNVFRMRLMGAEVIPVNAGSGTLKDAVNEAMRDWSATY
DKAHYLLGTAAGPHPFPTIVREFHRMIGEETRAQIMAKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVQLIGVEPAGKGLHTAEHGAAIGKGTTGILHGAYSYIMQDEDGQIEESYSVS
AGLDYPAVGPQHAHLHDIGRATYAAVTDDEALYAFQLLSRKEGIIPALESSHALAHALNM
ADEAEDGTIIVVNLSGRGDKDLAHVHSILGGQTNE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttagagagcaaattcggacagttcggtggtatgtatgtaccagaactgctt
attcccgcgcttgatcaattagagcaagcatttattgacgcgcaaaacgatcctgaattt
caaaaagagtttatggaattgcttaccgactacgcaggtcgccccacggcaatgaccttg
tcacgtaacttggtttccaacccaaatgtgaaactgtatttaaagcgtgaagatttactt
catggcggcgctcataaaaccaatcaggtactaggtcaagcactactgaccaagcgtatg
ggtaaaaccgaagtcatcgctgaaactggcgctgggcaacacggagttgcaacagcatta
gcctgcgcactgttaggcttaaaagcacgtatttacatgggagccaaagacgttgagcgt
caagcgccgaacgtgttcagaatgcgtttaatgggcgcagaagtcatccccgtaaacgca
ggctcaggcaccctgaaagatgccgtgaatgaagccatgcgtgactggtctgccacgtat
gacaaagctcactatctacttggcaccgcggctggtcctcacccgttcccgactatcgtg
cgtgaattccaccgtatgataggcgaagaaacgcgcgcgcaaatcatggccaaagaaggt
cgcttacctgatgcggtcgtcgcctgtgtgggtggtggttcaaacgctattggtatgttc
gctgactttattgacgagccaagcgtgcagttaatcggtgttgagccagccggtaaaggc
ttgcacacggctgaacacggcgctgcgatcggtaaaggcaccacaggcattttgcacggt
gcatatagctacatcatgcaagatgaagacggccaaattgaagaatcatattctgtatct
gcagggcttgattacccagccgttggtccccagcacgctcatttacacgatattggccgc
gccacctatgccgctgtcaccgatgacgaagcgctttatgcatttcaattattatcccgc
aaggaaggtatcattccggcccttgaatcatcacacgccttggcgcatgccttaaacatg
gcagatgaagccgaagatggcactatcatagtggttaatttgtccggtcgtggcgacaaa
gatttagcccacgtacacagtattttgggaggccaaaccaatgagtaa

DBGET integrated database retrieval system