KEGG   Pseudoalteromonas atlantica: Patl_2833Help
Entry
Patl_2833         CDS       T00372                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00260  Glycine, serine and threonine metabolism
pat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01130  Biosynthesis of antibiotics
pat01230  Biosynthesis of amino acids
Module
pat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Patl_2833
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Patl_2833
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Patl_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABG41343
UniProt: Q15RZ5
Position
3435165..3436352
Genome map
AA seq 395 aa AA seqDB search
MNHLESKFGQFGGMYVPELLIPALDQLEQAFIDAQNDPEFQKEFMELLTDYAGRPTAMTL
SRNLVSNPNVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQAPNVFRMRLMGAEVIPVNAGSGTLKDAVNEAMRDWSATY
DKAHYLLGTAAGPHPFPTIVREFHRMIGEETRAQIMAKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVQLIGVEPAGKGLHTAEHGAAIGKGTTGILHGAYSYIMQDEDGQIEESYSVS
AGLDYPAVGPQHAHLHDIGRATYAAVTDDEALYAFQLLSRKEGIIPALESSHALAHALNM
ADEAEDGTIIVVNLSGRGDKDLAHVHSILGGQTNE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttagagagcaaattcggacagttcggtggtatgtatgtaccagaactgctt
attcccgcgcttgatcaattagagcaagcatttattgacgcgcaaaacgatcctgaattt
caaaaagagtttatggaattgcttaccgactacgcaggtcgccccacggcaatgaccttg
tcacgtaacttggtttccaacccaaatgtgaaactgtatttaaagcgtgaagatttactt
catggcggcgctcataaaaccaatcaggtactaggtcaagcactactgaccaagcgtatg
ggtaaaaccgaagtcatcgctgaaactggcgctgggcaacacggagttgcaacagcatta
gcctgcgcactgttaggcttaaaagcacgtatttacatgggagccaaagacgttgagcgt
caagcgccgaacgtgttcagaatgcgtttaatgggcgcagaagtcatccccgtaaacgca
ggctcaggcaccctgaaagatgccgtgaatgaagccatgcgtgactggtctgccacgtat
gacaaagctcactatctacttggcaccgcggctggtcctcacccgttcccgactatcgtg
cgtgaattccaccgtatgataggcgaagaaacgcgcgcgcaaatcatggccaaagaaggt
cgcttacctgatgcggtcgtcgcctgtgtgggtggtggttcaaacgctattggtatgttc
gctgactttattgacgagccaagcgtgcagttaatcggtgttgagccagccggtaaaggc
ttgcacacggctgaacacggcgctgcgatcggtaaaggcaccacaggcattttgcacggt
gcatatagctacatcatgcaagatgaagacggccaaattgaagaatcatattctgtatct
gcagggcttgattacccagccgttggtccccagcacgctcatttacacgatattggccgc
gccacctatgccgctgtcaccgatgacgaagcgctttatgcatttcaattattatcccgc
aaggaaggtatcattccggcccttgaatcatcacacgccttggcgcatgccttaaacatg
gcagatgaagccgaagatggcactatcatagtggttaatttgtccggtcgtggcgacaaa
gatttagcccacgtacacagtattttgggaggccaaaccaatgagtaa

DBGET integrated database retrieval system