KEGG   Pseudoalteromonas atlantica: Patl_2834Help
Entry
Patl_2834         CDS       T00372                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00260  Glycine, serine and threonine metabolism
pat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pat01100  Metabolic pathways
pat01110  Biosynthesis of secondary metabolites
pat01130  Biosynthesis of antibiotics
pat01230  Biosynthesis of amino acids
Module
pat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Patl_2834
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Patl_2834
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Patl_2834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RD3
Motif
Other DBs
NCBI-ProteinID: ABG41344
UniProt: Q15RZ4
Position
3436345..3437187
Genome map
AA seq 280 aa AA seqDB search
MSNQNDHNDIHSSDRYDSMFTRLDAANEGAFVPFVMLGDPDIATSLEILKALAEGGADAL
ELGIPYSDPIADGPTIQQASIRALSHKIHPSDCFEVIRQFREIYPDTPIGLLLYSNLVIK
PGLEKFYNDAANAGVDSILIADVPLREADRFVAIANETGIKQILIAPPNASNETLAEIGQ
KSQGYTYLLGRAGVTGAETAATIPASELIAKLTQYKVAPPLLGFGISKPEQVKEAISAGA
AGAISGSATVNIIEKNLSQPEVMLSKLREFVSAMKQATKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaaatgatcataatgacatccatagcagcgaccgttacgacagtatgttc
acccgtttagatgcagcgaatgaaggcgcatttgtccctttcgtgatgctaggtgaccct
gacatcgccacgtccctagagattttaaaagccttggctgaaggcggcgcagatgctctt
gagttaggtattccttactctgatcctattgccgatggccctacgattcagcaagcgagc
attcgtgccctgagtcataaaattcaccccagtgattgttttgaggtgatccgtcaattc
cgtgaaatctaccctgatacacctattggcttgttgctgtacagcaacttagtgattaag
cccggtcttgaaaaattctataacgatgcagctaatgcaggtgttgactcgattctgatt
gctgatgtgccacttcgtgaagcagaccgctttgttgctattgccaacgaaacaggtatt
aagcaaatcctgattgctccgcctaacgccagtaatgagaccttggctgagatcggtcaa
aaatcacaaggttacacttacttacttggccgcgctggcgtaaccggcgctgaaacagct
gccaccattcctgccagtgagttgattgccaagttgactcagtacaaggtggctccgcca
ctattaggctttggtatctctaaacctgagcaagtcaaagaagcgattagcgcaggtgca
gccggcgctatttcaggctcggcaacagtgaatatcattgaaaaaaacctgtctcagcct
gaagtgatgcttagcaagcttcgtgagtttgttagcgctatgaaacaagcaactaaaaaa
taa

DBGET integrated database retrieval system