KEGG   Pseudoalteromonas atlantica: Patl_2895Help
Entry
Patl_2895         CDS       T00372                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pat  Pseudoalteromonas atlantica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pat03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3506713..3507315)
Genome map
AA seq 200 aa AA seqDB search
MKLSPLILELINAFKVLPGVGPKSAQRMAFHLLERNRSGALQLSQVLHNAMEHVGHCKQC
RTFTESELCEICAHPRRSEAGTLCVVESPQDVVAIEQTAEFKGLYFVLMGHLSPIDGIGP
SEIGLDELANLLDSKDLTEVILATNPTVEGEATAHYIGQMCSARDIQATRLAHGMPVGGE
LEYVDGNTLTHAFVGRRSLS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttagtcctcttattttagagcttattaacgcgtttaaagtgttacccggtgtg
ggcccgaaaagcgcccagcgcatggcgtttcatttgttagagcgaaatagaagtggtgcc
ttgcagttgagccaagtgttgcataacgccatggaacacgtggggcattgtaagcagtgc
cgtacgtttaccgaaagcgaattgtgtgaaatttgtgctcaccctagacgtagcgaagcg
ggcactttgtgcgttgttgagtccccccaagatgtggtggcgattgaacaaaccgctgaa
tttaaaggtttgtactttgtattgatgggacatttatcgcctatcgatggtattgggccg
agtgaaatcgggttagacgaactagcgaatttgttagacagcaaagatttgacggaagtg
atcctagccaccaacccgacggttgaaggcgaggcaacggcccattacattggccagatg
tgctctgcgagagacattcaagcgactcggttagctcacggtatgccggtgggtggcgag
ttagaatatgttgatggcaatacgttgacgcatgcttttgtgggtcgtcgaagcctgtct
tag

DBGET integrated database retrieval system