KEGG   Pseudoalteromonas atlantica: Patl_2914Help
Entry
Patl_2914         CDS       T00372                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Patl_2914
Enzymes [BR:pat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Patl_2914
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Patl_2914
Lipid biosynthesis proteins [BR:pat01004]
 Fatty acid synthase
  Component type
   Patl_2914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3530247..3530885
Genome map
AA seq 212 aa AA seqDB search
MFKLITNSLRMRAKVILILLPIILVSDQLWAKSSKLLILGDSLSAGYGLTQAQSWVSLLQ
DAWQKSDITVVNAAISGETTDGALARLPRLLTQHTPSHVYVELGGNDGLQGHSVSKMRDN
LTQIVKLSQESGATVILQEMQIPTNYGRRYTELFTQAYGTVASERDVTLLPFFLADIALN
NELMQSDGIHPNAKAQPMIAKSMQAALGPLIH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaattgataacgaattcattgcgcatgcgcgccaaagtcatattgatactttta
ccgataatattggtttcagatcaactttgggcgaaatccagtaaattgctaatattaggc
gatagcctaagtgctggttatggtttgacgcaagcacaaagctgggtaagtttgttacaa
gatgcgtggcaaaaaagcgacattaccgtcgtaaatgcggcgataagtggtgaaacaact
gacggggctttggcccgcttaccgagattactgactcagcataccccgagtcacgtgtat
gtggaattgggcgggaatgacggtttgcaggggcattcagtgagcaaaatgcgcgacaac
ctgactcaaatagtcaagttaagccaagagtcaggtgcaacggttattttgcaagaaatg
cagatccccacgaactatggacgcaggtacacagagctatttactcaggcgtatggcaca
gtggctagtgaacgtgatgtcaccttattgcctttttttctagcagacattgcccttaac
aacgagctaatgcaatccgacggaattcatccgaatgccaaagcacaacctatgatcgcc
aaatcgatgcaagccgcgctcggccctttgatacactag

DBGET integrated database retrieval system