KEGG   Pseudoalteromonas atlantica: Patl_3199Help
Entry
Patl_3199         CDS       T00372                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Patl_3199
   00052 Galactose metabolism
    Patl_3199
   00500 Starch and sucrose metabolism
    Patl_3199
   00520 Amino sugar and nucleotide sugar metabolism
    Patl_3199
Enzymes [BR:pat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Patl_3199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3841002..3841895)
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVNAGIKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEAVQAICPKDVTIMHVRQGVAKGLGHAVLCARP
MVGDAPFAVVLPDVIVDEGTCNPKKDNLADMTAKFNTSQVSQIMVESVPQEDVSKYGIVD
LDGAELSPGESAKMHGMVEKPNLSDAPSDLAVVGRYVLSEKIWDLLAKTTPGAGDEIQLT
DAIDSLMQTEQVDAYYMKGKSHDCGSKLGYMKANVEYAMRHPELGAEFNEFLQTLVK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtaaagaaagccgttattccagtagcaggtcttggaacgcgtatgttgcca
gcaaccaaggcgatcccaaaggaaatgctaccagttgttgataagccacttatccaatac
gttgtatccgaatgtgtgaatgcaggcataaaagagattatcttagtgactcatgcgagt
aaaaacagcatcgagaaccattttgataccagttttgagcttgaagccacgctagaaaag
cgtgttaaacgtcaactattggaagcggttcaagcaatctgccccaaagacgttaccatc
atgcacgtacgccaaggtgtcgctaaaggcttgggtcacgcagtattgtgtgctcgccct
atggttggtgatgcgcctttcgcagtggttctacctgacgttattgttgatgaaggtaca
tgtaatcctaagaaggataacttggcagacatgacggctaaatttaataccagtcaagtc
agccaaatcatggtggaaagtgttcctcaagaagatgttagcaagtacggtatcgttgat
ttagacggtgcagaactgtcacctggtgaatcagcgaagatgcacggtatggtagaaaaa
cctaacctatcagatgcgccatcagatttagctgttgttggacgttatgtattgtctgaa
aaaatctgggatcttctcgctaaaaccacgcctggtgcaggtgatgaaattcagctaaca
gatgctatcgattctttgatgcaaaccgagcaagttgatgcttattacatgaaaggcaaa
agccatgattgtggcagcaagttaggctacatgaaggcgaacgttgaatatgcgatgcgc
caccccgaattaggtgctgagtttaatgagtttttacagacgcttgtgaaataa

DBGET integrated database retrieval system