KEGG   Pseudoalteromonas atlantica: Patl_3533Help
Entry
Patl_3533         CDS       T00372                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pat00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4239824..4241317
Genome map
AA seq 497 aa AA seqDB search
MRIKDCILAIDQGTTSTRAIIFAPDSSIIAVAQQEFTQHYPNDGWVEHDPEDIWSSTVVV
CRQAISEAIAKGARIAAIGVTNQRETTVVWDRNTGQAIYNAIVWQDRRTAKTCREMQDKG
LFDVVNSRTGLLLDPYFSASKVAWILDNVEGAREKADAGDLAFGTIDSFLIWRLTDGQVH
ATDVTNASRTNLFNIHDMAWDPKLLEVFNVPKSVLPMVKECADDFGHTTEDLFGFSLPIL
GVAGDQQAASIGQCCFKEGAIKSTYGTGCFVMLNTGTKAFNSKNKLLTTVAYTIKGETHY
ALEGSIFIAGAAIQWLRDGLGVIKSASETEDLAKSLDDDHGVYMVPAFAGLGAPHWAPDA
RGAVFGLTRGTTNAHFVRAALESVCYQTSDLLHAMAEDGVSLDKIRVDGGMVGNNWLCQF
LAGILDVTVERPKIMETTALGAAYLAGLKAGIYASCEQLASMNEVESSFDAKMPSSQRRK
LIAGWENAVQSTLGYTK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaaagattgtatattagctattgaccaaggtactacttcaacacgagccatt
atttttgcgcccgactcgagcattattgccgtagcccaacaagaattcactcagcattac
ccaaatgatggttgggtagaacatgacccagaagatatttggtcatcaaccgttgtggta
tgtcgccaagctatttcagaagcaatagcaaaaggcgcccgtatcgcagcgattggcgtt
acgaatcaacgtgaaactacggtcgtgtgggatagaaacacaggccaagctatttacaac
gccattgtatggcaagatagacgcaccgcaaaaacgtgccgagaaatgcaagacaaaggc
ttgtttgacgtggtgaattcacgcacaggtttattgcttgacccatatttttccgcctca
aaggtcgcatggattttagataatgttgaaggggctcgtgaaaaagcagacgccggagac
ttggctttcggtacgattgattcgtttttgatctggcggttaacagacggacaggtgcac
gccactgatgtgaccaacgccagtcgcaccaacttattcaatatccatgacatggcatgg
gatccaaaactgctagaggtcttcaacgtccctaaatcagtgttacccatggtcaaagaa
tgcgctgatgactttggccatactaccgaagatttattcggcttttccttgccaatccta
ggtgttgcaggagaccaacaggccgccagcattgggcaatgttgcttcaaagaaggggcg
ataaagagcacctatggtactggctgttttgtcatgctaaatacaggcaccaaagccttt
aactctaaaaataaactgctcacgaccgtggcttacaccattaaaggtgaaacccattat
gcccttgaaggctcaatttttattgctggcgctgccattcaatggctgcgtgatggttta
ggcgtcattaaaagtgcttcagaaactgaagacttagccaagtcattggatgacgatcat
ggtgtatacatggtgccggcctttgcaggactaggcgcgccacattgggcgccagatgct
cgcggtgccgtattcggtttaactcgaggcaccactaatgcacacttcgtgcgcgcggcc
cttgagtcagtgtgttatcaaacctcagatttgctgcatgccatggcagaagatggcgta
tcactggataagattcgcgtcgatggcggtatggttggcaataactggttatgccaattc
ttggctggcattttagatgtcacagtagagcggcctaaaatcatggaaaccacagcccta
ggcgcggcttatcttgccggtcttaaagcgggcatctacgcgtcatgtgagcagctagcc
agtatgaacgaagtagaaagcagctttgacgctaaaatgccttcttctcagcgccgaaaa
ttaattgcgggctgggaaaacgcggtacaaagcacattaggttatacgaaatga

DBGET integrated database retrieval system