KEGG   Pseudoalteromonas atlantica: Patl_3534Help
Entry
Patl_3534         CDS       T00372                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pat00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pat00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4241314..4242396
Genome map
AA seq 360 aa AA seqDB search
MIKHRLFGTLPDGQKVTEYSLRNKVGMQVDILDLGGIIRRWLVPDAEPLKSDAPQAPVDI
VLGFDTLEDYIADQAYVGALVGRYANRIAKGHFALNDVNYQLDVNQGGNSLHGGFEGFNR
RVWQAQTLDNDAEASLMLTLTSDDGDQGFPGRLEVNVTYTLHETGLKITYRAKAAQDTVF
NPTQHSYFNLAGHNSGSIEDHQVQILASHYTPTDENAIPTGELVDVNNTPFDLREMTTLK
SPLQSSHKQIKLGNGFDHNWCLDAYQAKMNAPELVAKAFEPKSRRTMRVLTTMPGMQLYT
ANYVGPEPIGKGATEYQGKQAYCFETQFYPDSPNQSHFPSATLKANEEHYSVTEYRLSFS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacatcgtctttttgggacgctgcctgacggacagaaagtcactgaatacagc
ttgcgaaataaagtcggaatgcaggtagatattcttgatttgggcggcatcattcgtcgc
tggttagtgccagatgcagaaccgttaaaatcagatgcgccgcaggcaccagtggatatc
gtgcttggcttcgatactctcgaagattatatcgctgaccaagcttacgtaggggcactt
gttgggcgctacgcaaaccgtatcgccaaaggacatttcgctttaaacgatgtaaattat
cagttagatgtgaatcaaggtggtaacagcttacatggcggttttgaagggtttaatcgc
cgagtttggcaagcgcaaacactagataatgacgctgaagcctccttgatgctaacgctt
accagtgacgatggcgatcaaggctttcccggtcgattagaagtcaatgtgacttacact
ttgcatgaaacgggtttgaaaataacctaccgcgcaaaagcagcgcaagacacggtgttc
aatcctacccaacacagttactttaacttagccggacataacagcggctccattgaagat
catcaagtgcaaattttggccagtcattacaccccaaccgatgagaacgctatccccacg
ggggaattggttgatgtaaataacacgccgtttgacttgcgtgaaatgacgacacttaag
agcccattgcagtccagccataagcagataaaacttggtaatggctttgatcacaactgg
tgcttagatgcttaccaagccaagatgaatgcgccagagctggtcgctaaggctttcgag
ccaaaaagtcggcgcactatgcgtgttttgaccactatgcctggcatgcagctttacaca
gcaaattacgttggaccagagcccattggaaaaggcgcaacagagtatcaaggcaaacaa
gcatactgctttgaaacgcagttctacccagactcacctaatcaaagtcatttccccagc
gccacgcttaaggccaatgaagagcattactcggtgaccgaatatcgtttatccttttcg
tag

DBGET integrated database retrieval system