KEGG   Pseudoalteromonas atlantica: Patl_3682Help
Entry
Patl_3682         CDS       T00372                                 

Definition
FAD dependent oxidoreductase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pat00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4440756..4442396)
Genome map
AA seq 546 aa AA seqDB search
MNNLRKSNIRKLPKGTFDTLIIGGGINGAVAAAALAAKGVKVALIDKGDFAGFTSSNSSN
LAWGGIKYLESYEYGLVNKLCKSRNHLMRSYPSTVKEIRFLTSIQKGFRFPPAFIYMGTL
LYWVMGRLFTKMPNYLTGGKIKSLENVINTQNVTGGFEYSDAYLQDNDARFVFNFIRSSM
SYGCIAANYVESLGSTRENDMWVTKAKDGITGEEFEITSKVLINAAGPFVDPLNELNEEK
TDHHHVFSKGIHLIVDKVTDSNKVLTFFADDGRLFFVIPMGPKTCIGTTDTQVDNPYAHV
TEADRQFVLDNVNKLLALDKPLTKDDVIAERCGVRPLAIKGSGGKADWVQLSRKHAIDQN
AQHKYMSIFGGKLTDCINVGDEVAGIVKEFGIDLPYADFKWYGEPDDTVRDEFFHRAKLM
NFDALTPATSSEPLTSRFWRRYGRNAINMLEAIRENPHKAELLIENSEYLRVEIEHAAQR
EMVTKLEDFLRRRSKISLVVRQEDILNAPGLREACEILFGDEAEAKLQEYISSVRKDVSP
AADVIA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctgagaaagagtaacatccgtaaattgccgaaagggacatttgacacattg
atcattggcggcggcattaatggcgccgtggccgcggcggcactcgctgctaaaggtgtg
aaggtcgcgttgattgataaaggtgatttcgcgggctttaccagttctaactcttcaaat
ttagcctggggtggcattaaatatcttgaaagttacgaatatggtttggtcaacaagtta
tgtaaaagtcgtaatcatttaatgcgcagttacccgtctacagtgaaagaaatccgtttc
ttgaccagtattcaaaaaggctttcgttttccacctgccttcatatacatgggcacctta
ctgtactgggtaatgggccgactgtttactaaaatgcctaactacctcacgggcggtaaa
atcaagtcgctagaaaacgtgatcaatacccaaaatgtcaccggtggctttgaatactct
gatgcctatctgcaagacaatgatgcacgttttgtattcaattttattcgctcaagtatg
agttatggatgtattgcggcaaactatgttgagtcacttgggtcaactcgcgaaaatgat
atgtgggtaacaaaagcaaaagatggcatcactggcgaagagtttgagataacgtctaag
gtcctaatcaacgcagcagggccgttcgttgacccgttaaatgaattgaatgaagaaaag
acggatcatcatcatgtcttctcaaaaggtattcacttaatagtggataaagtaaccgac
agcaacaaggtacttaccttctttgccgatgatgggcgcttgtttttcgttatcccaatg
gggccaaagacctgtataggtaccacggatacgcaggtagacaacccttatgcacatgtc
acagaggctgaccgccaatttgtactcgacaacgttaataagcttctagcgcttgataag
ccattaaccaaagatgatgttattgccgagcgttgtggtgtgcgtccattagcgattaaa
ggctctggcggaaaagctgattgggtacaattgtcacgcaaacatgcgattgaccaaaac
gctcagcacaaatacatgtctattttcggtggcaaactcactgattgcatcaatgtgggc
gatgaagtagccggcattgtaaaagagtttggtatcgatctgccctatgccgatttcaaa
tggtatggcgagccagatgatactgtgcgcgatgaattctttcaccgtgccaagttaatg
aactttgatgctttaacacctgcaacttcttctgagccgctaacgtcgcgcttttggcgc
cgttatgggcgaaacgccatcaacatgcttgaagcgattcgggagaatccacataaggca
gagctactgattgaaaactcagagtatttacgggttgaaatagagcacgctgcccagcgt
gaaatggtcactaaacttgaagattttctgcgtcgacgttcgaaaatttctttggtggtg
cgacaagaagatattcttaatgcgccgggcttacgtgaggcctgtgaaatattattcggt
gatgaagcagaggctaaattgcaggaatatattagcagtgtacgtaaagatgttagtccc
gccgcagatgtgatagcttaa

DBGET integrated database retrieval system