KEGG   Pseudoalteromonas atlantica: Patl_3682Help
Entry
Patl_3682         CDS       T00372                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00564  Glycerophospholipid metabolism
pat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Patl_3682
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     Patl_3682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 GIDA HI0933_like Pyr_redox Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABG42184
UniProt: Q15PK4
Position
complement(4440756..4442396)
Genome map
AA seq 546 aa AA seqDB search
MNNLRKSNIRKLPKGTFDTLIIGGGINGAVAAAALAAKGVKVALIDKGDFAGFTSSNSSN
LAWGGIKYLESYEYGLVNKLCKSRNHLMRSYPSTVKEIRFLTSIQKGFRFPPAFIYMGTL
LYWVMGRLFTKMPNYLTGGKIKSLENVINTQNVTGGFEYSDAYLQDNDARFVFNFIRSSM
SYGCIAANYVESLGSTRENDMWVTKAKDGITGEEFEITSKVLINAAGPFVDPLNELNEEK
TDHHHVFSKGIHLIVDKVTDSNKVLTFFADDGRLFFVIPMGPKTCIGTTDTQVDNPYAHV
TEADRQFVLDNVNKLLALDKPLTKDDVIAERCGVRPLAIKGSGGKADWVQLSRKHAIDQN
AQHKYMSIFGGKLTDCINVGDEVAGIVKEFGIDLPYADFKWYGEPDDTVRDEFFHRAKLM
NFDALTPATSSEPLTSRFWRRYGRNAINMLEAIRENPHKAELLIENSEYLRVEIEHAAQR
EMVTKLEDFLRRRSKISLVVRQEDILNAPGLREACEILFGDEAEAKLQEYISSVRKDVSP
AADVIA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctgagaaagagtaacatccgtaaattgccgaaagggacatttgacacattg
atcattggcggcggcattaatggcgccgtggccgcggcggcactcgctgctaaaggtgtg
aaggtcgcgttgattgataaaggtgatttcgcgggctttaccagttctaactcttcaaat
ttagcctggggtggcattaaatatcttgaaagttacgaatatggtttggtcaacaagtta
tgtaaaagtcgtaatcatttaatgcgcagttacccgtctacagtgaaagaaatccgtttc
ttgaccagtattcaaaaaggctttcgttttccacctgccttcatatacatgggcacctta
ctgtactgggtaatgggccgactgtttactaaaatgcctaactacctcacgggcggtaaa
atcaagtcgctagaaaacgtgatcaatacccaaaatgtcaccggtggctttgaatactct
gatgcctatctgcaagacaatgatgcacgttttgtattcaattttattcgctcaagtatg
agttatggatgtattgcggcaaactatgttgagtcacttgggtcaactcgcgaaaatgat
atgtgggtaacaaaagcaaaagatggcatcactggcgaagagtttgagataacgtctaag
gtcctaatcaacgcagcagggccgttcgttgacccgttaaatgaattgaatgaagaaaag
acggatcatcatcatgtcttctcaaaaggtattcacttaatagtggataaagtaaccgac
agcaacaaggtacttaccttctttgccgatgatgggcgcttgtttttcgttatcccaatg
gggccaaagacctgtataggtaccacggatacgcaggtagacaacccttatgcacatgtc
acagaggctgaccgccaatttgtactcgacaacgttaataagcttctagcgcttgataag
ccattaaccaaagatgatgttattgccgagcgttgtggtgtgcgtccattagcgattaaa
ggctctggcggaaaagctgattgggtacaattgtcacgcaaacatgcgattgaccaaaac
gctcagcacaaatacatgtctattttcggtggcaaactcactgattgcatcaatgtgggc
gatgaagtagccggcattgtaaaagagtttggtatcgatctgccctatgccgatttcaaa
tggtatggcgagccagatgatactgtgcgcgatgaattctttcaccgtgccaagttaatg
aactttgatgctttaacacctgcaacttcttctgagccgctaacgtcgcgcttttggcgc
cgttatgggcgaaacgccatcaacatgcttgaagcgattcgggagaatccacataaggca
gagctactgattgaaaactcagagtatttacgggttgaaatagagcacgctgcccagcgt
gaaatggtcactaaacttgaagattttctgcgtcgacgttcgaaaatttctttggtggtg
cgacaagaagatattcttaatgcgccgggcttacgtgaggcctgtgaaatattattcggt
gatgaagcagaggctaaattgcaggaatatattagcagtgtacgtaaagatgttagtccc
gccgcagatgtgatagcttaa

DBGET integrated database retrieval system