KEGG   Pseudoalteromonas atlantica: Patl_3687Help
Entry
Patl_3687         CDS       T00372                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Patl_3687
  Lipid metabolism
   00561 Glycerolipid metabolism
    Patl_3687
   00600 Sphingolipid metabolism
    Patl_3687
Enzymes [BR:pat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Patl_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4449848..4452004
Genome map
AA seq 718 aa AA seqDB search
MTQHAAQFIALHGQKSSLVLDVGYETPQIIYWRAKLSEQSTGDMMRALRLRQEAPVSPIV
ELDLCITPTSGQGFTGLPGLSLHGGSDQWAANPKLKKVTQNNEYSVTLTSIDAARGVEVV
VTIKLDQDTDVLTFDTALNNITEQTITLDWCAAATIPTPADFDQIIGFEGHWAGEFQQHS
LDKFFGSYVRENRRGKTSHDSYPALLLHPKTTNQAQGEAYGFHLGWSGNHKIVAEKMADG
RSYVQMGELLFPGEIVLSKNQSYQTPTLFASYTDQGLSALSQQFHQYVRTHIIRQSVHDK
PRPVHYNTWEGIYFNHDVDTLKDLAERAAEMGAERFVLDDGWFIGRNDDTAGLGDWYVDK
AFYPEGLTPVIEHVKAQGLEFGLWFEPEMVNPDSDLYRQHPEWVLGNEVSKQIDCRNQLV
LDLSRPEVFEYLFERLDSLLSEYDISYVKWDMNRDLNHQGNHSGKPGGHNQIHAVYRLLD
KIREAHPQVEVESCASGGGRADYGVLARTDRVWTSDSNDALERLKIQNGFSYFLPSELMG
SHVGPRECHITHRTVSMEMRASVTLFGHMGMEMDLRELTDAEKVELKAMTDLYKQHRALV
HSGDLFRLELPAYMNGLGIVAKDKSQALFSYSLVACSSATLPDQYKFAGLDKNSQYKLDI
IWPIKNTDKWPKSGLFGFVNHLGAVDGQVFSGELLMQLGMQMPLLTPQSSLLFHLTKV
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacatgcagcacaattcattgcccttcatgggcaaaagagcagcctagtttta
gacgtcgggtatgaaacaccacaaataatttactggcgcgctaagctgtcagaacaatcc
actggcgatatgatgcgcgcgcttcgcttacgtcaagaagcgcccgtctcccctattgtt
gaacttgacctatgcatcacacctacatccggccaaggctttactgggttacctgggcta
agtttgcatggcggcagcgaccagtgggctgcgaaccctaagttaaagaaagtgacacag
aataatgaatacagcgtcacgcttaccagcatagatgccgctcgcggtgttgaagtcgtt
gtcaccataaaactagaccaagacacagatgtactgacttttgataccgctttaaataac
atcactgagcaaaccatcacgcttgactggtgcgcagcagccactattccaaccccagcg
gactttgatcaaattatcggctttgaaggccattgggcgggtgagtttcaacaacactcg
ctggataaattctttggctcatacgtgcgcgaaaatcgtcgtggcaaaacctcacacgac
agctatccagccctattgttgcaccctaaaaccaccaatcaagctcaaggtgaagcctat
ggttttcatttaggttggagtggtaatcacaaaatcgtcgctgaaaaaatggctgatggt
cgctcttatgtgcagatgggcgagttgttatttccgggtgaaatagtgttaagtaaaaat
cagagttaccagacgccaactctgtttgccagttacacagaccaaggcttatcagcttta
tctcagcagtttcatcaatatgtgcgcacgcatatcattcgccaaagcgtgcacgacaaa
cctcgaccggtgcattacaacacttgggaaggcatctacttcaaccacgacgtagacaca
ctgaaagacttggccgaaagagccgcagaaatgggcgccgagcgttttgtattagatgat
ggttggtttattggccgtaacgatgacacagcagggttaggagactggtacgtggacaaa
gcgttttacccagaagggttaacgcctgttattgagcatgtcaaagcccaaggcttagaa
tttggcttgtggttcgagccagaaatggtcaacccagatagtgacctataccgccagcac
cctgagtgggtgttaggcaacgaagtcagcaagcaaatagactgccgtaatcaattggtg
ctcgatttatctcgcccagaagtattcgaatatttgttcgagcgtttagactctttgtta
tcagaatatgatattagctacgtaaaatgggacatgaaccgtgatttgaaccatcaaggc
aaccatagcggtaagccaggtggccataatcaaatacatgcggtgtatcgcttattggat
aaaattcgtgaagcccatccgcaagtggaagttgaaagctgtgcatcgggtggcggtcgt
gctgactatggcgtactggcgcgcactgaccgcgtatggacttcagattctaacgacgca
cttgagcgcctaaaaattcaaaatggtttctcgtatttcttgccttcagagctaatgggc
tcacacgtaggcccaagagagtgtcacattacccaccgcactgtttcaatggaaatgcgc
gcttcagtgaccttgttcggccacatgggcatggaaatggatttacgtgagctaacagat
gccgagaaagtcgagctcaaagctatgaccgacttatacaaacaacatcgagcattagtg
cacagcggcgatttgttccgcttagagcttccggcctatatgaatgggctaggtatcgtt
gccaaagacaagtcacaagcactgttctcgtacagtttagtagcatgcagctcggccacc
ctgccggatcaatataagtttgcaggtttagacaagaacagccaatacaagctcgatatc
atttggccaataaagaacactgacaaatggccaaaatctggtctgtttggtttcgttaat
caccttggtgctgttgatggtcaagtctttagtggtgaattattgatgcaattgggtatg
caaatgccattgttgacgccacaaagcagtttgttgttccatcttacaaaagtgtaa

DBGET integrated database retrieval system