KEGG   Pseudoalteromonas atlantica: Patl_3713Help
Entry
Patl_3713         CDS       T00372                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pat  Pseudoalteromonas atlantica
Brite
Enzymes [BR:pat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Patl_3713
Secretion system [BR:pat02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Patl_3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4474995..4475780)
Genome map
AA seq 261 aa AA seqDB search
MKLFFPIRVLSLSVQVGIYMKYRALFVAAFAFLSVSLSVSAASGSSQNLDSVKQKIQMSL
GMQVTSIGDAPVPGLLQVQTDKGLFYTSDDGKYFLQARIFNLDEGMRNETETTLTKMRVD
GVEHFKNSVIEYKAEKEKYVVNVFTDITCGYCRKLHNQMDEYNDLGITVRYLAFPRAGLN
SKPYQDMVSVWCSANPQKALNEAKGGENVAKASCSNQVAEQYNFGQSVGVNGTPNIILPD
GSVVPGYQPPMQLLQAIQDAS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttttccctattagggtcttatctttatctgttcaagttggaatttatatg
aaatatcgtgcgttatttgtggctgcttttgcctttttatcggtcagcctgagtgttagt
gctgcatcaggtagcagtcaaaaccttgatagtgttaagcaaaaaattcaaatgtcatta
ggcatgcaagtcacgtctattggcgatgcgccggttccaggcttattacaagtacaaact
gataaaggcttgttttacaccagtgacgatggcaaatatttccttcaagcccgtatattt
aatctagatgaaggcatgcgtaacgagacagaaacaacattgaccaaaatgcgtgttgat
ggggtggagcacttcaaaaattctgtgattgaatacaaagcagagaaagaaaagtacgtg
gtgaatgtgtttactgatattacctgtggatattgccgtaagttgcataatcaaatggat
gaatacaatgatttaggcattaccgttcgttatttagcctttcctcgcgctggcttaaac
agcaagccgtatcaagatatggtgtcagtctggtgttcagctaatccgcaaaaagcgtta
aatgaagcgaaaggcggcgaaaacgtcgctaaagcaagttgttcaaatcaagtcgctgag
cagtataattttggtcagagtgtaggtgtaaatggtacgcctaatattattttacctgat
ggcagcgtggtgcctggctaccaaccaccgatgcaattattgcaagctattcaagacgcc
tcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system