KEGG   Pseudoalteromonas atlantica: Patl_3726Help
Entry
Patl_3726         CDS       T00372                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Patl_3726
   00051 Fructose and mannose metabolism
    Patl_3726
Enzymes [BR:pat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Patl_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4489191..4490510
Genome map
AA seq 439 aa AA seqDB search
MAEYFKDIPKVKFEGTSSDNPLAFRHYNPEELVLGKSMKEHLRLAACYWHNFCWDGADVF
GAGTFNRPWLQAGDAMQRAKEKADVAFEFFSKLNIPYYCFHDVDVSPEGNSIKEYINNFA
QMTDVLEAKQEETGLKLLWGTANLFSNPRYASGAASSPNPEVFTYGATQVMHAMNATKRL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTK
HQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSIDANRG
DPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGM
DHLAIGLKKAALMIENDFLGQAVSKRYAGWNGELGKGIQGGDFNLESLANLCVDKNLQPK
HVSGQQELLENKVNNVLYG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatattttaaagatatccctaaagtaaaatttgaaggtaccagttcagacaac
ccattagcatttcgccattacaacccagaagaactggtgctaggcaagagcatgaaagaa
catttacgcctagcggcgtgttactggcacaacttctgttgggacggcgctgatgtattt
ggcgcaggtacgtttaatcgcccttggctgcaagcaggtgatgccatgcagcgcgcaaaa
gaaaaagctgacgtcgcgtttgagtttttctcaaagctaaatattccttattactgcttc
cacgatgttgatgtttcccctgagggcaactcaattaaagagtacattaacaactttgct
cagatgactgacgtactagaagccaaacaagaagaaacgggtcttaagttgttatggggc
accgcaaacttgttcagtaacccacgttacgctagcggtgctgcatctagcccgaaccct
gaagtattcacttatggcgcgactcaagtaatgcacgctatgaatgcgactaagcgatta
ggcggtgaaaactacgtgctttggggtggtcgtgaaggttacgaaaccttgctaaatacc
gatttacgccaagagcgtgagcaactcggtcgtttcatgaacatggttgttgagcataag
cataaaattggctttaaaggattattgctaatcgaacctaagccacaagagccgactaag
caccagtacgattacgacaccgcaactgtttatggcttcttgaagcaatacggtttagaa
aacgaatttaaagtgaacattgaagctaaccacgccaccttggccggccactcgttccag
catgaagtcgctacggctatatcacttggcttatttggtagcatcgatgccaaccgaggt
gaccctcaactaggttgggataccgaccaattcccgaatagcgttgaagaattgtcattg
gttatttatgaaattcttaaagcgggtggttttacatctggtggctttaactttgatact
aagttgcgtcgtcaaagctcagatccacaagatatgttcatcgcccacattggcggcatg
gatcacttagcaattggcttgaaaaaagccgcgctgatgattgaaaatgacttccttggt
caagctgtcagcaagcgttacgcaggttggaacggcgagctaggtaagggtattcaagga
ggcgatttcaaccttgagtcactcgctaacctctgcgtagataagaacctacaacctaag
cacgtcagtggccagcaagagttattagagaacaaggttaataacgttttatacggctaa

DBGET integrated database retrieval system