KEGG   Pseudoalteromonas atlantica: Patl_3726Help
Entry
Patl_3726         CDS       T00372                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pat00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pat00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4489191..4490510
Genome map
AA seq 439 aa AA seqDB search
MAEYFKDIPKVKFEGTSSDNPLAFRHYNPEELVLGKSMKEHLRLAACYWHNFCWDGADVF
GAGTFNRPWLQAGDAMQRAKEKADVAFEFFSKLNIPYYCFHDVDVSPEGNSIKEYINNFA
QMTDVLEAKQEETGLKLLWGTANLFSNPRYASGAASSPNPEVFTYGATQVMHAMNATKRL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMNMVVEHKHKIGFKGLLLIEPKPQEPTK
HQYDYDTATVYGFLKQYGLENEFKVNIEANHATLAGHSFQHEVATAISLGLFGSIDANRG
DPQLGWDTDQFPNSVEELSLVIYEILKAGGFTSGGFNFDTKLRRQSSDPQDMFIAHIGGM
DHLAIGLKKAALMIENDFLGQAVSKRYAGWNGELGKGIQGGDFNLESLANLCVDKNLQPK
HVSGQQELLENKVNNVLYG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatattttaaagatatccctaaagtaaaatttgaaggtaccagttcagacaac
ccattagcatttcgccattacaacccagaagaactggtgctaggcaagagcatgaaagaa
catttacgcctagcggcgtgttactggcacaacttctgttgggacggcgctgatgtattt
ggcgcaggtacgtttaatcgcccttggctgcaagcaggtgatgccatgcagcgcgcaaaa
gaaaaagctgacgtcgcgtttgagtttttctcaaagctaaatattccttattactgcttc
cacgatgttgatgtttcccctgagggcaactcaattaaagagtacattaacaactttgct
cagatgactgacgtactagaagccaaacaagaagaaacgggtcttaagttgttatggggc
accgcaaacttgttcagtaacccacgttacgctagcggtgctgcatctagcccgaaccct
gaagtattcacttatggcgcgactcaagtaatgcacgctatgaatgcgactaagcgatta
ggcggtgaaaactacgtgctttggggtggtcgtgaaggttacgaaaccttgctaaatacc
gatttacgccaagagcgtgagcaactcggtcgtttcatgaacatggttgttgagcataag
cataaaattggctttaaaggattattgctaatcgaacctaagccacaagagccgactaag
caccagtacgattacgacaccgcaactgtttatggcttcttgaagcaatacggtttagaa
aacgaatttaaagtgaacattgaagctaaccacgccaccttggccggccactcgttccag
catgaagtcgctacggctatatcacttggcttatttggtagcatcgatgccaaccgaggt
gaccctcaactaggttgggataccgaccaattcccgaatagcgttgaagaattgtcattg
gttatttatgaaattcttaaagcgggtggttttacatctggtggctttaactttgatact
aagttgcgtcgtcaaagctcagatccacaagatatgttcatcgcccacattggcggcatg
gatcacttagcaattggcttgaaaaaagccgcgctgatgattgaaaatgacttccttggt
caagctgtcagcaagcgttacgcaggttggaacggcgagctaggtaagggtattcaagga
ggcgatttcaaccttgagtcactcgctaacctctgcgtagataagaacctacaacctaag
cacgtcagtggccagcaagagttattagagaacaaggttaataacgttttatacggctaa

DBGET integrated database retrieval system