KEGG   Pseudoalteromonas atlantica: Patl_4032Help
Entry
Patl_4032         CDS       T00372                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pat01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pat01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4855663..4856790
Genome map
AA seq 375 aa AA seqDB search
MEKPRLILTNVLVFVITGLVALFLVPYVALTQGFDGAEIAACIILIYFSGMSITAGYHRL
WAHKAYEANTFVRVVLAIGGAMALQNSILHWVSDHRIHHRHVDDNDKDPYSAKRGFWYSH
MGWMLREYQIHRYSDYSNCKDLQKDKVVVWQHKYYLPIMLISNFGIPMALGWLNGDVLGM
VLLAGFFRLVVVHHVTFFINSLAHIWGRQPYTDKNTARDNDILAFFTFGEGYHNYHHIFE
YDYRNGIKWWQFDPTKWLIRGLSFIGWTKNLRRCPEERIEKAKMAMQLQRAQQKLSVLPN
ADEILHSLQQEYDAILHKMGEMYATKKRLMEIRKHKLKRNYEKLELDFKYRELKYNLELR
KQKWLQLYQVKYQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaccccgtttaattctcactaatgttttagtctttgtgattactggactagtc
gcactctttcttgtgccttacgttgctctaacccaagggtttgatggcgcagagatcgct
gcgtgtattattcttatttacttctcagggatgtctatcaccgctggataccacaggctg
tgggcgcataaagcctatgaagcgaatacctttgtcagagtcgtactggctattggcgga
gcaatggcccttcaaaacagcatattacattgggtttctgatcacaggatccaccacagg
catgtggacgacaacgataaagacccgtattcggccaagcgtggcttttggtattcacac
atgggttggatgcttcgcgaatatcagatacaccgctattctgattatagtaattgtaaa
gaccttcaaaaagacaaggtcgttgtatggcagcataagtactaccttcccatcatgctt
atttctaactttggcattccaatggcattaggttggttgaatggtgatgtgcttggtatg
gtgttgcttgctggttttttccgcctagtggttgtccatcatgtgacgttttttattaat
tctcttgcccatatttggggacgtcaaccttatacagataaaaatacagcccgcgataat
gacattttagcttttttcacttttggtgaggggtaccataattaccaccacatatttgaa
tatgattaccgcaatggcattaaatggtggcagtttgatccaactaaatggctaatacga
gggctgtcgtttataggctggaccaaaaacttacgccgctgcccagaagaacgtattgag
aaagcgaagatggcgatgcaattgcagcgcgcacaacagaagttatctgtgcttccaaat
gccgatgagatattacatagtttacagcaggaatatgatgcaatcttgcataaaatgggc
gaaatgtacgccactaaaaaacgcttaatggaaattcgcaaacataaattgaagcgtaat
tacgagaaactagaactagattttaaataccgcgaactcaaatacaatttagagttacga
aagcaaaaatggctgcagctgtatcaagtaaaatatcaaatggcttag

DBGET integrated database retrieval system