KEGG   Pseudoalteromonas atlantica: Patl_4065Help
Entry
Patl_4065         CDS       T00372                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00052  Galactose metabolism
pat00511  Other glycan degradation
pat00600  Sphingolipid metabolism
pat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Patl_4065
  Lipid metabolism
   00600 Sphingolipid metabolism
    Patl_4065
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Patl_4065
Enzymes [BR:pat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Patl_4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ABG42564
UniProt: Q15NH4
Position
complement(4888127..4891264)
Genome map
AA seq 1045 aa AA seqDB search
MTYPQSSTVPDWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEWDFHW
VKAPNLRPLDFYTPEFDSSQWDKIAVPGNWQLLGYGAANYINTAVDFAKHPIAGDVPEDN
NPVGSYRRHFALPDNWQDKHVFVYLGAVKSAFYIWVNGHKVGYSQDSKTPAEFDITQYVQ
AGDNVIALEVYRWSDGTYLELQDMWRLSGIERDVYVYSTPKVRIRDFHALSTLDNQYLHG
EFSLAVNIHSHVGGQESAGKDYQLQARLFDSDLTPVFEQTVTLENWESQCTDLLLTGKIK
NVAKWSAETPHLYQLKLTLLNEKREPLQYIYSRVGFRTSELKNGNVLINGQPVLFKGVNR
HDHDPVTGHVISRDSMRRDMQLLKQFNINAVRTSHYPNDPYWYALADEYGMYLVDEANIE
SHGIGAANQAISYEPKDHMGNMPNWKGAYLDRVSNMYERDKNHPSIVIWSIGNETGDGPN
MEALYDWLKTKTSMPVMSEQAQLRRHTDMYSQMYAPIPVLEHYAELGETRPLILCEYEHA
MGNSMGNLADYWRVIEHYPLLQGGFIWDWVDQTFALTSEDGTPYWGYGGDMEEPGMYHDG
NFSANGVMAADRTPNPHAFEVQAVYQHMNIERVDFEKHTIAVRNKRYFTDLSDVSLHWRI
EENGHVVESGVIEELEIPAQSTRELSLSVAVKPTAGAEYFANFEFVSRFGSDMIPAGFTV
ARSQIPLTHLSEAVHKSQDITKEACAKHDMFRANETDAQLQCSGDDFSIEFDLATGLLCA
YQLQNESMLLEAIRPEFWRAPTDNDFGEGFPEKAKDWQYGGQHIELSAFNWQSLKNDQGQ
IQAIEVSTEHYLTDVQSRYLSKYTIDADGCVTFDIWLYAAPHQFHSALPRIGSLLQMPSQ
FDQVSWFGRGPHENYWDRKTSAFVGRYAKSVDELYFPYVRPQENGYRSDVRSVTFSNDNG
LGLTFDGLPQIGFGAQRYDVHEYDQFDKRGLHPHELTKHDRLFINIDYKQRGVAGTDSWG
TAPLFKYTLPWRDYHYGFIMKPCRA
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcctcaatcttctactgtgcctgattggcaaaaccccgaagtattcgccatt
aacaaagagccagcgcgtagctcattttatggcttttcagatgacccacaggggtacgta
gattcgccgtttatgtctcaagactatttgagtcttaatggtgagtgggattttcattgg
gtgaaggccccaaacttgcgaccattagacttttacactcctgaatttgactccagtcag
tgggataaaatagccgtcccgggtaattggcaattgttgggctatggtgcggcgaactac
atcaatacagcagtggatttcgctaagcacccgattgcaggtgatgtgcctgaggacaat
aacccagtaggctcttatcggcgtcactttgccttgcctgataattggcaagataagcac
gttttcgtctatttaggggcagtgaaatcggcgttttatatttgggtaaatggccataaa
gtcggttactcacaagattccaaaacccctgcagaatttgatattacccagtacgtgcaa
gcgggtgataacgtgattgcactggaggtgtaccgctggtctgacggcacttatctagaa
ttacaagatatgtggcgtttatcgggcattgagcgtgacgtgtatgtatatagtacacct
aaggtacgcatacgcgactttcatgctttgagcacccttgataaccaatacctgcatggg
gagttttcattagcagtcaatatacattcgcatgtagggggccaagaaagtgcgggaaaa
gactatcagttacaggcgcgcttatttgactctgatttaactcccgtttttgagcaaacc
gttacattagagaattgggagtcacaatgtactgacttgcttttgaccggtaagataaaa
aatgtggccaagtggagcgccgaaacaccgcacttatatcaactaaaactgaccttgctt
aacgaaaagcgtgaacctttgcagtacatatactcccgcgttggttttcgaactagtgag
ttgaaaaatggcaatgtgttgatcaacggtcagcccgtgctattcaaaggggttaaccgc
catgatcacgaccctgttacgggacacgtgataagtcgcgattccatgcgccgagatatg
cagctgctcaagcagtttaatattaatgcggtacgaacttctcattacccaaatgatcct
tattggtatgcgctggcggacgaatatggaatgtatctggtggatgaagccaatattgag
tcccatggcataggcgcagcgaaccaagcgatatcttacgagcctaaagaccatatgggt
aacatgcctaactggaaaggcgcgtatcttgatcgagtctccaatatgtacgagcgagac
aagaatcacccgagtattgttatttggtcaatcggtaatgaaacgggcgatgggccgaat
atggaagcgttatatgattggctgaaaaccaaaaccagcatgcccgtgatgtcagagcaa
gcccaattgcgtcgtcatacagatatgtatagccagatgtatgcgcccatccctgtgctt
gagcactacgcggagctcggcgaaacccgcccgctcattttatgcgagtacgagcacgct
atgggtaactccatgggcaacttagctgattattggcgggtgattgagcactatcctctt
ttgcaagggggattcatatgggattgggtagaccaaacctttgcactgacgtcagaagac
ggcacgccgtactggggatacggtggtgacatggaagagccgggtatgtatcacgatggt
aacttcagtgctaatggggtgatggcggcagacagaactcctaaccctcatgcatttgaa
gttcaagcggtttatcagcacatgaatattgagcgggttgatttcgaaaagcacaccatt
gccgttagaaataagcgctactttactgatttatctgacgtctcgctgcattggcgcatc
gaggaaaacggccatgttgtcgaaagtggggtgattgaggaattggagattccagcacaa
tccactcgtgagctttctttgagtgtggctgtaaaaccaacagcgggtgctgagtacttc
gctaactttgagtttgttagtcggtttggcagcgatatgatcccagctgggtttactgtg
gctcgcagtcaaatcccgttgacgcatttatctgaagctgtgcataaatcacaagacatc
acaaaagaagcttgtgcaaagcacgatatgttcagggctaatgaaactgatgcccaactg
caatgcagcggagatgatttctcgattgaatttgatttagcaacagggctgttatgtgct
taccaattgcaaaacgaatcaatgttgcttgaagcaatccgccctgaattttggcgagca
cctacggacaatgactttggtgaaggctttcctgagaaagccaaagattggcagtacggc
gggcaacatatcgaattaagcgcatttaattggcaatcactaaagaatgatcaagggcaa
attcaggctattgaggtttccacagagcactatttaacagacgtacaaagccgttattta
agcaaatacaccattgatgctgatggctgtgtcacctttgatatttggctttatgctgca
cctcatcaatttcacagtgccttgccgcgaataggaagtttgctacaaatgcctagccag
ttcgaccaagtaagttggtttggacgcggcccgcacgaaaactattgggaccgcaagact
tcggcttttgtagggcgctacgctaaatcggttgatgaattgtatttcccttatgttcgg
ccccaagaaaatggttatcgcagtgatgtgcgtagcgtgaccttcagtaatgacaatgga
ctaggtttgacctttgatggattaccgcaaatcggttttggcgcacaacggtatgacgtg
cacgaatatgatcaattcgacaagcgcggtttgcacccacatgaacttacaaaacacgat
cgcctgtttatcaatattgattacaaacagcgtggtgtggcaggtactgattcttgggga
actgcgccattgtttaaatacactttgccatggcgtgattatcactatggatttatcatg
aagccgtgtcgagcataa

DBGET integrated database retrieval system