KEGG   Pseudoalteromonas atlantica: Patl_4162Help
Entry
Patl_4162         CDS       T00372                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pat  Pseudoalteromonas atlantica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pat00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Patl_4162
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Patl_4162
Enzymes [BR:pat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Patl_4162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5009172..5011073
Genome map
AA seq 633 aa AA seqDB search
MGFRPLRLCFVVFFVIACISCTSKPSIDPKIEALVAQKLMLDIRYFCDENELDATTQRCT
TPVTTLPDDLKEMIADTGVGGIILFANNLVDTEQMLRLNRDLQAASASGGHSPLLISIDQ
EGGRVVRIPQNISTAFSGNMAIGATYAEHGTHFATLSGDVIAKELAVLGFNVNFAPSVDV
NVNPENPVINVRSFGEDPQVVAELGLAQMQAMQQNGIIAALKHFPGHGDTSTDSHSGLPL
VEHDLHKIKAVDLAPFQYAIDNGDPGMIMTAHIQYPALDSSTFTATDGSKTILPATMSRA
ILTDLLRDQMGFRGVIITDALDMAAIAHFYEPTQAVLQTFKAGTDIALMPLAIRTAQDIP
KLKKMIADLAYAVQIGDVTLAEIETSVARIQTLKHNYIPSNTAQLSPAKALARAQSILAA
PAHLKIEQDLADNAIVAIKNQQAWPISQSTKRIHLVMPDKSKCMAMTTALTDALNTFDPR
PELTMSCASLVSEPTDNLLALQRDAQLVIYTDITPQQSLVEMGGMDDIIDWRSRPNKEAL
DAKLLTLLKDIKPHQKSLMVSMRTPYAVTQYADYLDGILATFAYNTQVTEQLDENGAARA
HYEGPIYRALANILFGNQQASGSLPVSIGKIQH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaggccgttgcgtttgtgttttgtcgttttcttcgttatcgcttgtatttca
tgcacaagcaaaccatcaatcgatcctaaaattgaagccttagttgcgcaaaaactgatg
ctcgatattcgctatttctgtgatgaaaacgagcttgatgcaaccacacagcgctgcact
acacctgtcaccacgttacccgatgaccttaaagaaatgattgctgacacaggtgtaggc
ggcataatcttatttgccaataacttggtcgacacagaacaaatgcttcgcctgaatcgt
gacttgcaagcagcctcagccagtggcgggcactctccactgcttatctctatcgatcaa
gaaggcgggcgcgtggtgcgcatcccgcaaaatattagtactgcatttagcggcaatatg
gccattggtgccacatacgccgaacatggaacacactttgccacgcttagcggtgatgtg
attgctaaagagttagccgtactgggttttaacgttaattttgctccttcagttgatgta
aacgtcaatccagaaaaccctgtgataaacgtgcgctcattcggggaagacccacaagtg
gtggctgaactgggattagctcaaatgcaggcaatgcaacaaaacggcattattgctgcg
ctgaaacactttcctgggcacggggataccagcaccgatagtcactcgggcttacccttg
gttgaacatgacttacacaaaataaaagcggtagatttagcgccatttcaatacgccatt
gataatggcgatccgggcatgatcatgacggcacatattcaatacccagcccttgatagc
tcaacatttactgccactgacggcagcaagacaatactaccggctaccatgtctcgggca
attttaaccgacttgctcagagaccaaatgggctttcggggcgtgatcatcacagatgcg
ttagatatggccgccatcgcccatttttatgagcctacccaagcggtattgcaaacattc
aaggcgggtactgacatcgcactaatgccactggctattcgcactgcacaggacattcct
aagcttaaaaaaatgattgctgatctagcttatgccgttcaaattggcgacgtaacgtta
gctgaaatagagacgtcagtagcgcgtattcaaaccttaaaacacaattatattccgtct
aatactgcccagttatccccagccaaagcactcgctcgggcgcaaagtatattggctgcg
cctgctcatctaaaaatagagcaagacttagcggataacgccattgtggcgattaaaaat
cagcaagcatggccgataagccaatccactaagcgcattcatctcgtcatgccagacaag
agtaaatgcatggccatgacaactgcactaactgatgcacttaacacatttgacccacgg
cctgaactgacaatgagctgtgccagcttagtgagcgagccaacagataaccttcttgcc
ctacagcgtgacgcacaattagtgatttacaccgatattaccccgcagcaaagcttggtt
gaaatggggggaatggacgatattattgattggcgctcaagaccgaataaagaagcgctg
gatgccaagcttctcaccttactgaaagacattaaaccccatcaaaaatcgcttatggtg
agtatgcgcaccccttatgcagtgacccagtacgcagattatctggatggcattttggcg
acctttgcttataacacccaagttactgagcaattagatgaaaacggagcagcccgtgcc
cactacgaaggtcctatttatcgcgctttggccaatattctgttcggtaatcaacaggcc
tcgggatcgctgccagttagcattggtaagattcagcattaa

DBGET integrated database retrieval system