KEGG   Pseudoalteromonas atlantica: Patl_4269Help
Entry
Patl_4269         CDS       T00372                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pat  Pseudoalteromonas atlantica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pat01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pat00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5137851..5138948)
Genome map
AA seq 365 aa AA seqDB search
MSQLSWQRAVIKVGSALIAPDGKACSSKYLLPIAQFIVTSRAQGKEVILVSSGSVAAGRG
KIGYKHHPSIAEKQAMAAIGQTHMMANWARLFDFDCAQILLTSDDLHNRTRYVNIKNTLR
ELLRNNALPIVNENDTVAINELKVGDNDNLAAYTALVAQADTLIICSDIDGLYEADPRQN
PLAKFIPTVHEIDQSIHDLAGGAGTSVGTGGMRTKIQAAEKCAKSGIQTLIVNGRNPDVF
EQLAQGRQPGTLFLPMKNQDGARNQWLRHTLRSKGTLVIDEGAQKALIHKGASLLPSGIT
SVLGAFKPGEAVDIRFKDQIIGKGLSLYGNSELQQIKGQRSDRIEPILGYSSGEVAIHRD
DLVLL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactctcgtggcaacgggccgttatcaaagtcggtagtgcccttatcgcccct
gacggcaaagcgtgtagtagtaaatacttgttacccatagcgcaatttattgtgaccagc
cgcgctcaggggaaagaggtgattttagtctcttcaggtagtgttgcagctggacgcggt
aaaattggctataaacatcacccatcgatcgctgaaaagcaggcgatggctgcgattggg
caaacgcatatgatggcgaattgggcgcgtttatttgatttcgactgcgcacaaatcttg
ctgacgtctgatgatctgcataatcgcactcgctacgtcaatatcaaaaacacgttacga
gaactgctgcgtaacaatgcgctaccaatcgtgaatgaaaacgacacggttgctattaat
gaattaaaagtaggcgacaatgataacttagcggcttataccgcgttagttgcccaagct
gatactttgattatttgttctgatattgatggcttgtatgaagcagacccaaggcaaaac
ccacttgccaagttcattccgacggtacatgagattgatcaaagtattcatgacttagcc
ggtggagccggtacaagtgtgggtactggaggcatgcgcaccaaaattcaggccgccgag
aagtgtgctaaaagtgggattcaaacgttaatcgtcaatggtcgcaatccagatgtgttt
gagcaacttgctcaagggcggcagccgggaacgttattcttgcccatgaaaaaccaagac
ggtgctcgtaatcagtggttacggcatacgttgcgctcaaaaggtacgttagtcattgat
gagggtgctcagaaggcgctgatccataaaggcgcttcgctgcttccttcaggtattacc
agtgtcttaggggcgtttaaacccggtgaagcggttgatattcggttcaaagaccagata
atagggaaaggcctttccctatatggcaatagtgagttgcagcaaataaaggggcaacga
agcgatagaatcgaacctattctaggttattcatcgggtgaggttgccattcatcgtgac
gatttggttttactctag

DBGET integrated database retrieval system