KEGG   Pectobacterium atrosepticum 21A: GZ59_13080Help
Entry
GZ59_13080        CDS       T03293                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pato00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GZ59_13080 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    GZ59_13080 (atoB)
   00640 Propanoate metabolism
    GZ59_13080 (atoB)
   00650 Butanoate metabolism
    GZ59_13080 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    GZ59_13080 (atoB)
   00072 Synthesis and degradation of ketone bodies
    GZ59_13080 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GZ59_13080 (atoB)
   00310 Lysine degradation
    GZ59_13080 (atoB)
   00380 Tryptophan metabolism
    GZ59_13080 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GZ59_13080 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GZ59_13080 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GZ59_13080 (atoB)
Enzymes [BR:pato01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GZ59_13080 (atoB)
Exosome [BR:pato04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GZ59_13080 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1438424..1439602)
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIDMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASKAAGLPFETPSLTISKVCGSGLKAVVMGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDQVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLHLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcgattggtaaattcgcaggc
agtctggccaacacatcggctatcgacatggcatctgccaccatccgtgactgcctgtcg
acgctgccggacacgctggcgattgatgaagtgattctcggcaacgtgctgcaagccggt
ctggggcaaaaccccgcgcatcaggccagcaaggctgctgggctgccttttgaaacaccc
tcgctcaccatcagtaaggtgtgtggttccggcctgaaggccgttgtgatgggcgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaggatggtctgtggtgtgcgtttaacgattaccacatgggtaccacg
gcggaaaatatcgccgagcgctaccagctcacgcgagaagaacaggatcaggtggcgctg
gcatcacagcagaaagccgtcgccgcgattgaggctggccgcttcaaagccgaaataacc
ccgctgtcactgcgtagcaaaaaagagacgcggattttcgatcgggatgaattccctcgc
gccgacaccacgctggcatcgctggccgcgttacgtccggcgttttccgctaacggcacc
gtcaccgcaggcaatgcgtccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcggatccgcagttgggcgtct
gctggagtaccgagtgaagtgatggggctggggccgattccggcgacgcagaaagcactg
ctcaaggctgggctgacgatcggtgatattgacctgattgaagcaaatgaagcttttgcc
gcacagtttctagcggtacagcgcgatcttcatctcgatccagagaaagtgaacgtcaac
ggcggtgcgattgcgttgggccaccctatcggcgcgagcggtgcgcgtattctcgtcacg
ctggtacatgcgctgcacagctataacaaaacgctgggattggcgacgctgtgcatcggc
ggtgggcaaggtatcgcgatgatcgtcgaacgcgtttaa

DBGET integrated database retrieval system