KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_03770Help
Entry
PA14_03770        CDS       T00401                                 

Gene name
speB1
Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
Enzymes [BR:pau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     PA14_03770 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337768..338724
Genome map
AA seq 318 aa AA seqDB search
MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
LRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGDGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TMMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaccatccgcagcccctcgacgccgccgagattccacgcttcgccggtatc
ccgaccttcatgcgcctgccggcgttcaccgacccggcggcgctgcaggtcggcctgatc
ggcgtgccctgggacggcggcaccaccaaccgcgccggtgcccgccatggcccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcattgcgccctac
gacctggtgcgggtcggcgacctcggtgatgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgcatcgaaggcttctatcgccaggtccatgccgccggtaccctgccgctg
tcggtcggtggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccattccgccgggccatcgaggaaggtctgctcgacccg
ctgcgcacggtgcagatcggcattcgtggctcggtgtattcgccggacgacgacgctttc
gcccgcgagtgcggcatccgcgtgatccacatggaagagttcgtcgaactgggcgtcgag
gcgaccctggccgaagcccggcgggtggtgggcgacgggccgacctatgtgagtttcgac
gtcgacgtgctcgacccggccttcgcgcctggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcaactggtccgtggcctgcgcgggctggacctggtcggcgcc
gacgtggtggaagtctcgccgccgttcgatgtcggcggcgccacggcgttggtgggggcg
accatgatgttcgaactgctctgcctgcttgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system