KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_07600Help
Entry
PA14_07600        CDS       T00401                                 

Gene name
folk
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654237..654779
Genome map
AA seq 180 aa AA seqDB search
MSLIPVYLGLGSNVERERHLRAGLDALAGFLHDLRCSPVFESEPVGIKSGPFFNLVVSAR
TDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLFYGDLVGDFDGLVLPRAEVLKNAF
VLWPLSELAPNLEHPVARQPLGDLWRETRIQQKLWPAPFEWRGQALTPEALLQAFPRSSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgatcccggtctacctcggcctcggcagcaatgtcgagcgtgagcgccacctg
cgtgccggcctcgatgcgctggccggtttccttcatgacctgcgttgctcgccggtgttc
gagagcgagccggtgggtatcaagagcgggccgttcttcaacctggtggtgtctgcccgc
accgatctgccgctggccgaactgagcctgcgactcaagcacatcgaggccgacaatggc
cgctatgcgccagagcgcaagggactgccgctggatatcgacgtgctgttctacggcgac
ctggtgggcgatttcgatggcctggtgctgccgcgcgccgaagtgctgaagaatgctttc
gtgctctggcccttgtccgagctggcgccgaacctggagcatccggtcgcccgccagccg
ctgggcgatctctggcgcgagacgaggatccagcagaagctctggccggcgccattcgaa
tggcgtggccaggcgttgactcccgaagcgctgcttcaggcctttccgcgttcttccttg
tag

DBGET integrated database retrieval system