KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_10240Help
Entry
PA14_10240        CDS       T00401                                 

Gene name
acoC
Definition
(GenBank) putative hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00010  Glycolysis / Gluconeogenesis
pau00020  Citrate cycle (TCA cycle)
pau00620  Pyruvate metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Module
pau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_10240 (acoC)
   00020 Citrate cycle (TCA cycle)
    PA14_10240 (acoC)
   00620 Pyruvate metabolism
    PA14_10240 (acoC)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PA14_10240 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_5 Esterase Ndr GCV_H Abhydrolase_3 PGAP1 AXE1 PAF-AH_p_II Lipase_3
Motif
Other DBs
NCBI-ProteinID: ABJ13424
UniProt: A0A0H2ZG39
Position
complement(881150..882262)
Genome map
AA seq 370 aa AA seqDB search
MSRIHTLTMPKWGLSMTEGRVDAWLKEEGAHIEKGDEVLDVETDKISSSVEAPFSGVLRR
KVAREDETLAVGALLGVVVEGEASDEEIDALVQRFQAEFVPADEDAGDSGPAPRKVELDG
RLLRYFDRGEGDPALLLIHGFGGDLNNWLFNHEALAAERRVIALDLPGHGESGKALVRGD
LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIGSAGLGEEING
DYLRGFVEAANRNALKPQLVQLFSDPELVTRQMLEDMLRYKRLEGVDAALRQLLDNLFAD
GRQRNDLRAVASEGRQPVLAIWGSDDAIIPARHAEGLPAQVEIIPGQAHMVQMEAAEQVN
RLLLDFLRQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccatacactgaccatgcccaagtggggcctgtcgatgaccgagggtcgg
gtggacgcctggctcaaggaagagggcgcgcatatcgagaaaggcgacgaggtgctcgac
gtggagaccgacaagatctccagcagcgtcgaggcgcccttctcgggcgtgctgcggcgc
aaggtggcgcgcgaggacgagaccctggcggtcggcgcgctgctcggcgtggtggtcgag
ggcgaggcgagcgacgaggagatcgacgcactggtgcaacgcttccaggccgaattcgta
cccgccgacgaggacgctggggatagcggaccggcaccgcggaaagtcgagctggacggg
cgcctcctgcgctatttcgaccgcggcgagggcgatccggcgctactgctgatccacggt
ttcggtggcgacctgaacaactggttgttcaaccacgaggcgctggccgccgagcggcgg
gtgatcgctctagacctgccgggccacggcgagtccggcaaggccctggtgcgcggcgac
ctcgatgaactcagcggcagcgtgctggccctgctcgaccacctcgacctggaacaggta
cacctggccggtcactccatggggggagcggtggcgctgaactgcgcgcgcctggcgccg
cagcgggtgctgtcgctgagcctgatcggcagcgccggcctcggcgaggagatcaacggc
gactacctgcgcggcttcgtcgaggcggccaaccgcaacgcgttgaagccgcaactggtg
cagttgttctccgaccccgagctggtcacccggcagatgctcgaggacatgctccgctac
aagcgcctggaaggcgtcgatgcggccctgcgccagttgctggacaacctgttcgccgac
ggtcgccagcgcaacgacctgcgtgccgtggcgagcgagggccgccagccggtcctggcg
atctggggcagcgatgacgcgatcatcccggcgcggcatgccgagggcctgccagcccag
gtggagatcattcccggacaggcgcacatggtgcagatggaggccgccgagcaggtcaac
cgcctgctgctcgacttcctccgccagcattga

DBGET integrated database retrieval system