KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_13330Help
Entry
PA14_13330        CDS       T00401                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PA14_13330
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PA14_13330
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA14_13330
Enzymes [BR:pau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PA14_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144659..1146221
Genome map
AA seq 520 aa AA seqDB search
MSGMDLKRRRVVQGLGAGLLLPALGAPAVIASPRARPKLTDGVQSGDVQGDRALVWSRTD
RPARMIVEWDTRSVFSEPRRLVSPVTDERLDYTARIDLRGLPADQSIFYRVRFEDARDGS
LSKPWFGHLRSAPSEARNIRFVWSGDTCGQGFGINPDIGGMRIYEAMRRRQPDFFLHSGD
TIYADGPIPERIETESGRIWRNRVTEAKSKVAETLDEFRGNYRYNLLDDNLRRFNAEVPQ
IWQWDDHETTNNWSSSKQLDERYQVKDIDVLAARARQAFLEYAPLRFQRQGRDGRIYRKV
AYGPLLDVFVLDMRSYRGGNSANLQARRSAATDFLGREQLQWLKRELRGSRAQWKVIAAD
MPIGLCVPDGKDAQGRDRWEAIANGNDGAALGRELEIADLLRFVQRAGVRNTVWLTADVH
YCAAHHYSPERAAFKDFAPFWEFVAGPLNAGSFGPNALDGTFGPQVMFQKAPLVQNSSPF
AGYQFFGEVEIDAQSRALTVTLRDLDGEPVFSQELQPDGA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggatggacctcaagcgccgccgcgtcgtgcaaggcctgggcgctggactgctg
ttgccggcgctgggcgcgccggcggtgatcgcctcgcccagggcgcggccgaagctgacc
gatggcgtgcaatccggcgatgtgcagggcgaccgcgcgctggtctggagccgcaccgac
cgcccggcgcggatgatcgtcgaatgggacacccgtagcgtcttcagcgagccgcgccgg
ctggtctcgccggtcaccgacgagcgcctcgactacaccgcgcgcatcgacctgcgtggc
ctgccagccgaccagtcgatcttctaccgggtgcgcttcgaggatgcccgcgacggcagc
ctgagcaagccctggttcggccacctgcgcagtgcgccgagcgaggcgcgcaatatccgt
ttcgtctggagcggcgacacctgcgggcaaggtttcgggatcaatccggatatcggcggc
atgcgtatctacgaagccatgcgccggcgccagccggatttcttcctgcacagcggcgat
accatctatgccgatgggccgatccccgaacgcatcgagaccgagagcgggcgcatctgg
cgcaaccgggtgaccgaggccaagagcaaggtcgccgagaccctcgacgagttccgcggc
aactaccgctacaacctgctcgacgacaacctgcgccgcttcaacgccgaggtgccgcag
atctggcaatgggacgaccacgagaccaccaacaactggtcctccagcaagcagctcgac
gagcgctaccaggtgaaggacatcgacgtgctggcggcccgcgcgcgccaggcgttcctc
gaatacgcgccgctgcgcttccagcgccaggggcgcgacgggcggatctaccgcaaggtc
gcctacggccctttgctcgacgtgttcgtcctcgacatgcgcagctaccgcggcggcaac
agcgccaacctgcaggcgcggcgcagcgccgccaccgatttcctcggccgtgaacagttg
caatggctcaagcgcgagttgcgcggttcgcgcgcgcagtggaaggtgatcgccgccgac
atgccgatcggcctctgcgtgcccgatggcaaggacgcccagggccgcgaccgctgggag
gccatcgccaatggcaacgacggtgccgccctcggtcgcgagctggagatcgccgacctg
ctgcgcttcgtccagcgcgccggggtgcgcaacaccgtctggctgaccgccgacgtgcat
tactgcgcagcccaccactacagcccggagcgcgccgcgttcaaggacttcgcgccgttc
tgggagttcgtcgccgggcctctcaatgccggtagtttcggacccaacgcgctggatggc
acgttcggcccgcaggtgatgttccagaaggccccgctggtccagaacagctcccccttc
gccggctaccagttcttcggcgaggtggagatcgatgcgcaaagccgcgcgctcaccgtc
accctgcgcgacctcgacggcgagccggtgttttcccaggaactgcagcccgacggcgcc
tga

DBGET integrated database retrieval system