KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_16480Help
Entry
PA14_16480        CDS       T00401                                 

Gene name
wspF
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pau00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA14_16480 (wspF)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PA14_16480 (wspF)
Two-component system [BR:pau02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PA14_16480 (wspF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412043..1413050
Genome map
AA seq 335 aa AA seqDB search
MRIGIVNDMPLAVEALRRALAFEPQHQIVWVASNGAEAVTQCAADTPDVVLMDLLMPVMD
GVEATRRIMAESPCAIVIVTVDIEQNVHRVFEAMGYGALDAVNTPALGIGNPQTAAAPLL
RKIQNVGWLIGQRDNRGKVQVVPPKAGGARQRLVAIGASAGGPASLAVLLKQLPASFNAA
VVLVQHVDEVFAAGMAEWLASESKLPVRLARDGEPPIPGQILLAGTNNHIRLLRNGSLVY
TAEPRSFVYRPSIDVFFESVANYWRGDAVGVLLTGMGRDGAQGLKQMRERGFLTIAQDQA
SCAVYGMPKAAAAIDAAVQILSLEKIAPRLAEVFD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaggatcggaatcgtcaatgacatgccgttggccgtcgaggcgctgcgccgcgcgctg
gccttcgagccgcagcaccagatcgtctgggtcgccagcaacggtgccgaggcggtgacc
cagtgcgccgccgatacgcccgacgtggtgctgatggacctgctcatgccggtgatggac
ggcgtcgaggcaactcgtcggatcatggcggaaagtccttgcgcgatcgtgattgttacc
gtcgatatcgagcagaatgtgcaccgggttttcgaagcgatgggatatggggcgctcgat
gcggtgaacacgccggcgctgggcatcggcaacccgcaaacggcggcggcgccgttgttg
cgcaagattcagaacgtcggctggctgatcggccagcgcgataaccgtggcaaggtccag
gtggtgccgccgaaggccggcggggcgcgccagcgtctggtggcgatcggcgcctcggct
ggcggtccggcgtcgctcgcggtgttgctcaagcaactgccggccagtttcaatgccgcg
gtggtgctggtgcagcatgtcgacgaggtattcgccgccggcatggccgaatggctggcc
agcgaatcgaagctgccggtgcgcctggcgcgcgatggcgagccgccgataccggggcag
atcctgctggcggggaccaacaatcacatccgcctgctgcgcaacggttcgctggtgtac
accgccgaaccgcgttctttcgtctaccggccgtccatcgacgtgtttttcgagagcgtg
gcgaattattggcgtggcgatgccgtgggcgtgctgctgaccggcatgggccgcgatggc
gcccagggcctcaagcagatgcgcgagcgcggcttcctcaccatcgcccaggaccaggcc
agttgcgcggtctacgggatgccgaaggccgcggcggcgatcgatgccgcggtgcagatc
ctttccctggaaaagatcgccccgcgcctggcggaggtattcgattag

DBGET integrated database retrieval system