KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_17130Help
Entry
PA14_17130        CDS       T00401                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-d-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00900  Terpenoid backbone biosynthesis
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA14_17130 (dxr)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PA14_17130 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABJ12883
UniProt: Q02RC2
Position
1467925..1469115
Genome map
AA seq 396 aa AA seqDB search
MSRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVP
EQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAG
KRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRIL
LTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQ
PSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAV
GRLDFQRPDEQRFPCLRLASQAAETGGSAPAMLNAANEVAVAAFLERRIRFSDIAVIIED
VLNREAVTAVESLDQVLAADRRARSVAGQWLTRHAG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaccgcagcggatcagcgtgctcggcgcgaccggctcgatcggcctgagcacc
ctggacgtcgtccagcgtcatcccgatcgttacgaagccttcgccctgaccggcttcagc
cgcctggccgaactcgaggcgctgtgcctcaggcaccgccccgtctatgcggtggtgccg
gagcaggccgcggcgatcgccttgcagggctcgctcgccgcggcgggtatccgcacccgg
gtgctgttcggcgagcaggcgttgtgcgaagtggccagcgcgcccgaagtggacatggta
atggcggccatcgtcggcgccgccgggctgccgtcgaccctggcggccgtcgaggccggc
aagcgcgtactgctggccaacaaggaagcgctggtgatgtccggcgcgctgttcatgcag
gcggtcaagcgcagcggcgcggtgctcctgccgatcgacagcgagcacaacgcgatcttc
cagtcgctgccgcgcaattatgccgatggcctggagcgggtcggcgtgcgccggatcctc
ttgaccgcctccggcggcccgttccgcgagacgccgctggagcaactcgcttcggtgacg
ccggagcaggcttgtgcgcacccgaactggtcgatggggcggaagatttccgtcgattcc
gccagcatgatgaacaaggggctcgaactgatcgaggcgtgctggctgttcgacgcccag
ccgagccaggtcgaggtggtgatccacccgcagagcgtgatccactcgatggtggactac
gtcgacggctcggtgatcgcccagctcggcaatccggacatgcgcacgccgatttcctat
gccatggcctggccggagcgaatcgattccggcgtttcgccgctggacatgttcgccgtc
ggtcgcctggatttccagcgccccgacgagcagcgcttcccctgcctgcgcctggcgagc
caggccgcggaaaccggcggcagcgccccggccatgctgaatgccgcgaacgaggtggcc
gtggccgcatttctcgagcggcgcatccgcttcagcgacatcgcggttatcatcgaggac
gtgctgaaccgcgaggcggtgaccgcagtcgaatcgctcgatcaggtcctggccgccgat
cgccgcgcccgttcggtcgccgggcaatggttgacccgacacgccggctag

DBGET integrated database retrieval system