KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_17880Help
Entry
PA14_17880        CDS       T00401                                 

Gene name
paaJ
Definition
(GenBank) acetyl-CoA acetyltransferase (thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PA14_17880 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    PA14_17880 (paaJ)
   00640 Propanoate metabolism
    PA14_17880 (paaJ)
   00650 Butanoate metabolism
    PA14_17880 (paaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PA14_17880 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    PA14_17880 (paaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_17880 (paaJ)
   00310 Lysine degradation
    PA14_17880 (paaJ)
   00380 Tryptophan metabolism
    PA14_17880 (paaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PA14_17880 (paaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA14_17880 (paaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PA14_17880 (paaJ)
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PA14_17880 (paaJ)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_17880 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1534832..1536037
Genome map
AA seq 401 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMGKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILASASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGA
SGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERCR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggtgca
ctctcgacggtgcgtccggacgacctggccggcctgctgctggcgcgtctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaacgcgctgctcgcagccggcctgccggcgcggctg
cctgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cgcgcgatcagttgcggcgagggccggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatgggcaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaggatgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgaaatccttccggtggaggtgcgcgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcggccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggcggggtagtgaccgccggcaacgcgtcggggatcaacgacggggcggcg
gtagtgctgctgggcgaccgcgcgatcggcgagcgcgagggcatccggccgctggcgcgg
atcctcgctagcgccagcgtcggcgtggagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagctgctcggcctggactac
gaggacccgcgggtcaatccccatggcggcgccatcgccctcggccatccgctcggcgcc
tccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctac
gcggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtgatcgagcgctgc
cgatga

DBGET integrated database retrieval system