KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19740Help
Entry
PA14_19740        CDS       T00401                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PA14_19740
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PA14_19740
   00650 Butanoate metabolism
    PA14_19740
  Lipid metabolism
   00071 Fatty acid degradation
    PA14_19740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_19740
   00310 Lysine degradation
    PA14_19740
   00360 Phenylalanine metabolism
    PA14_19740
   00380 Tryptophan metabolism
    PA14_19740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA14_19740
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PA14_19740
   00281 Geraniol degradation
    PA14_19740
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA14_19740
   00627 Aminobenzoate degradation
    PA14_19740
   00930 Caprolactam degradation
    PA14_19740
Enzymes [BR:pau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PA14_19740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702924..1703694
Genome map
AA seq 256 aa AA seqDB search
MSVIVERNGPVTTLVIARPERRNAVDRPTAQALADALREFEADDTARVAVLTGSGGNFCA
GADLAAVAEDGERRNRLEAEGDGPMGPSRMQLGKPLIAAIEGYAVAGGLELALLADLRVM
AEDAICGVFCRRFGVPLIDGGSVRLPRIVGQGRALDLILTGRPVKADEALQIGLANRVVP
SGSARAEAEELAAELAAFPQTCMLADRASVYAQWELSFDVALANEFQGGLAVIESGETLE
GAQRFKDGEGRHGRFE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcatcgtcgaacgcaacggcccggtcaccaccctggtcatcgctcgcccggag
cggcgcaatgcggtggaccggccgaccgcccaggccctggccgacgccctgcgcgagttc
gaagcggacgatacggcgcgggtcgcggtactcaccggcagcggcggcaatttctgcgcc
ggcgccgacctggcggcggtagccgaggatggcgagcggcgcaatcgtctggaggcggag
ggcgacgggccgatggggccgagccgcatgcagctcggcaagccgctgatcgccgccatc
gaaggctatgcggtggccggcgggctggagctggcgctgctcgccgacctgcgggtgatg
gccgaggacgccatctgcggagtgttctgccggcgtttcggggtgccgctgatcgatggc
ggcagcgtgcgcctgccgcggatcgtcgggcagggccgggcgctcgacctgatcctcacc
gggcgtccggtgaaggccgacgaagcgttgcagatcggcctggccaaccgggtggtgccg
agcggttcggcgcgagccgaggccgaggagctggcggcggaactcgccgccttcccgcag
acctgcatgctcgccgaccgcgccagcgtatatgcgcagtgggaactgtccttcgacgtg
gccctggccaacgaattccagggcggactggcggtgatcgagagcggcgagaccctggag
ggcgcgcagcgcttcaaggacggcgaggggcgccacgggcgcttcgagtga

DBGET integrated database retrieval system