KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_19920Help
Entry
PA14_19920        CDS       T00401                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00010  Glycolysis / Gluconeogenesis
pau00020  Citrate cycle (TCA cycle)
pau00620  Pyruvate metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Module
pau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_19920
   00020 Citrate cycle (TCA cycle)
    PA14_19920
   00620 Pyruvate metabolism
    PA14_19920
Enzymes [BR:pau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PA14_19920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABJ12671
UniProt: A0A0H2ZEB3
Position
1716776..1717888
Genome map
AA seq 370 aa AA seqDB search
MKHFKLPDLGEGLQEAEIVEWHVKAGDSVRADQRLVSVETAKALVDIPAPYDGVVGKLFG
AEGDILHVGEPLVGFEGEEADAGTVVGRLEGGGSALEDRFFIGAAPSTREHLAPRATPAV
RQFARQQGVELAGLSGSGPDGLITRADVEAAAQGARERFGGERLRGVRRSMALNMARSHA
EVVPVTIYGDADLHRWKTARDPLIRLAQALAEACRAEPTLNAWFDGASLSLKLHERLDLG
IAVDTPDGLFVPVLRDVGARSAEDLRAGMRRLREDVQARSIPPAEMLGATLTLSNFGTLF
GRYANPVVVPPQVAILGAGGIRDEVVAWRGEMAIHPILPLSLSFDHRAATGGEAARFLKV
LVNALEQPDG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttcaagctgcccgacctgggcgagggcctgcaggaagcggaaatcgtcgaa
tggcacgtcaaggccggcgacagcgtgcgcgccgaccagcgcctggtctcggtggaaacc
gccaaggcgctggtggacatccctgcgccctacgatggggtggtgggcaagctgttcggc
gccgagggcgacatcctccacgtcggcgaaccgctggtgggcttcgagggcgaggaggcg
gacgccggtaccgtggtggggcgcctggagggcggcggtagcgccctggaagaccgtttc
ttcatcggcgccgcaccgtccacccgcgaacacctggcaccgcgcgcgaccccggcggtg
cgccagttcgcccgccagcagggcgtcgaactggccggcctgagcggctccggcccggat
ggcctgatcacccgcgccgacgtcgaggccgccgcccagggcgcccgcgaacgcttcggc
ggcgagcgcttgcgcggggtacggcggagcatggcgctgaacatggcgcgctcgcatgcc
gaggtggtgccggtgacgatctacggcgacgccgacctgcatcgctggaagaccgcacgc
gacccgttgatccgcctggcccaggcgctggccgaggcctgtcgcgccgagccgaccctc
aacgcctggttcgatggcgcctcgttgtcgctgaaactgcatgagcggctcgacctgggg
atcgccgtggacaccccggacggcctgttcgtgccggtgctgcgcgacgtcggtgcgcgt
tcggcggaggacctgcgcgccggtatgcggcgcctgcgcgaagacgtccaggcacgctcg
atcccgccggcggaaatgctcggcgcgaccctgaccctatccaacttcggcaccctgttc
ggccgctacgccaaccccgtggtggtgccgccgcaggtggccatcctcggcgccggcggc
atccgcgacgaagtagtggcctggcgcggcgagatggcgatccacccgatcctgccgctc
tcgctgagcttcgatcaccgcgccgccaccggtggcgaggcggcgcgtttcctcaaggta
ctggtgaacgccctggagcagcccgacggctga

DBGET integrated database retrieval system