KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_20200Help
Entry
PA14_20200        CDS       T00401                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:pau00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740354..1742264)
Genome map
AA seq 636 aa AA seqDB search
MSDDTKSPHEETHGLNRRGFLGASALTGAAALVGASALGSAVVGREARAAGKGERSKAEV
APGELDEYYGFWSGGHSGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESKRVLGDGAR
FLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDVMKCDRIVTIPNVQAIHGLRL
QKVPHTRYVFCNAEFIIPHPNDGSTFDLSGDNAFTLYNAIDAETMEVAWQVIVDGNLDNT
DMDYSGRFAASTCYNSEKAVDLGGMMRNERDWVVVFDIPRIEAEIKAKRFVTLGDSKVPV
VDGRRKDGKDSPVTRYIPVPKNPHGLNTSPDGKYFIANGKLSPTCTMIAIERLGDLFAGK
LADPRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAVRAYKGEKVDYIR
QKLDVQYQPGHNHATLCETSEADGKWIVVLSKFSKDRFLPTGPLHPENDQLIDISGEEMK
LVHDGPTFAEPHDCILARRDQIKTRKIWDRKDPFFAETVKRAEKDGIDLMKDNKVIREGN
KVRVYMVSMAPSFGLTEFKVKQGDEVTVTITNLDEIEDVTHGFVMVNHGVCMEISPQQTS
SITFVADKPGVHWYYCSWFCHALHMEMCGRMLVEKA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacacgaaaagcccccacgaagaaacccatggcctgaaccgccgcggcttc
ctcggcgcctcggcgctgaccggagccgccgccctggttggcgccagcgccctgggcagc
gcggtggtcggccgcgaggcccgggccgcgggcaagggcgagcgcagcaaggccgaggtc
gcccccggcgaactggatgagtactacgggttctggagcggcggacattccggcgaagta
cgcgtgctcggcgtgccgtcgatgcgcgagctgatgcgcataccggtgttcaacgtcgac
tcggccaccggctggggcctgaccaacgagagcaagcgggtcctcggcgacggcgcgcgc
ttcctcaacggcgactgccaccatccgcacatctcgatgaccgacggcaagtacgacggc
aagtacctgttcatcaacgacaaggccaacagccgggtcgcgcgcatccgcctggacgtc
atgaaatgcgaccgcatcgtcaccattcccaacgtccaggcgatccacggcctgcgcctg
caaaaggtgccgcatacccgctacgtgttctgcaacgccgagttcatcatcccccatccc
aacgacggctcgaccttcgacctgtccggcgacaacgccttcaccctgtacaacgccatc
gacgccgagaccatggaagtggcctggcaggtgatcgtcgacggcaacctcgacaacacc
gacatggactacagcggcaggttcgccgcctccacctgctacaactcggagaaggccgtc
gacctcggcggcatgatgcgtaacgagcgcgactgggtggtggtgttcgacatcccgcgc
atcgaggccgagatcaaggcgaagcgcttcgtcaccctcggcgactcgaaggtgccggtg
gtcgacggccggcgcaaggacggcaaggacagcccggtgacccgctacatcccggtaccg
aagaacccccacgggctgaacacctcgccggacggcaagtacttcatcgccaacggcaag
ctctcgccgacctgcaccatgatcgccatcgagcgcctcggcgacctgttcgccggcaag
ctggccgacccgcgcgacgtggtggtgggcgagccggaactgggcctcggcccgctgcac
accaccttcgatggccgaggcaacgcctataccacgctgttcatcgacagccagttggtg
aagtggaacctcgccgacgcggtgcgcgcctacaagggcgagaaggtcgactacatccgc
cagaagctcgacgtgcagtaccagccggggcacaaccacgccaccctgtgcgagaccagc
gaagccgacggcaagtggatcgtggtgctcagcaagttctccaaggaccgcttcctgccc
accggtccgctgcacccggagaacgaccagttgatcgacatttccggcgaggaaatgaag
ctggtccacgacggtccgaccttcgccgaaccgcacgattgcatcctcgcccgccgcgac
cagatcaagacccgcaagatctgggaccgcaaggacccgttcttcgccgagacggtcaag
cgcgcggaaaaggacggcatcgacctgatgaaggacaacaaggtcatccgcgagggcaac
aaggtccgcgtctacatggtctcgatggcgccctccttcggcctcaccgagttcaaggtg
aagcagggcgacgaagtcaccgtgaccatcaccaacctcgacgagatcgaggacgtgacc
cacggcttcgtcatggtcaaccacggcgtctgcatggagatcagcccgcaacagacctcg
tcgatcaccttcgtcgccgataagcccggggtgcactggtactactgcagctggttctgc
cacgccctgcacatggaaatgtgcgggcggatgctggtggaaaaggcttga

DBGET integrated database retrieval system