KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_22930Help
Entry
PA14_22930        CDS       T00401                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00010  Glycolysis / Gluconeogenesis
pau00052  Galactose metabolism
pau00500  Starch and sucrose metabolism
pau00520  Amino sugar and nucleotide sugar metabolism
pau00521  Streptomycin biosynthesis
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_22930 (glk)
   00052 Galactose metabolism
    PA14_22930 (glk)
   00500 Starch and sucrose metabolism
    PA14_22930 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PA14_22930 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PA14_22930 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PA14_22930 (glk)
Enzymes [BR:pau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PA14_22930 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABJ12418
UniProt: Q02PZ9
Position
1988578..1989573
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFARRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggcggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccacggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggttggggcggcggat
ttccgtttcaccaacaaccactgggtgatcaatcgcgccgcgttccgcgaggagctgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggctg
ggcgcggacgagctggtgcaggtccgggccggcagcgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggcgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcatgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacacgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgtgccctggacggggtcgccgtc
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgc
ttcatcgccagcggtttcgccgaggccttcgccaggcgtggcaagaccagtggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgctcggcgccggc
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system