KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_25990Help
Entry
PA14_25990        CDS       T00401                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PA14_25990
Enzymes [BR:pau01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PA14_25990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270442..2271455
Genome map
AA seq 337 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQPPPAERAE
IIRRRLAFDADPQAFVERWEGQQDNLRRRCAEARRQLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSSPPPSAANPPPPPAAP
AALPERAGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgaactgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccgggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaggtgaacctgctaccggaccacctggtggatttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgcctcgacacccagccgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgttgggaa
ggccagcaggacaacctgcgccgccgttgcgccgaggcacgccggcaactggcgcggatt
cccctggacgatgcggcgctggacagcatcgcccgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgagcccgccgccatcggcggccaatccaccgccaccgcccgcggcccct
gccgcgctcccggagcgcgccggcgacggcgaagggcagtggggcgaattgccggctcgg
ccggtggccatggggaccgcccgcgagctgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system