KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_27160Help
Entry
PA14_27160        CDS       T00401                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PA14_27160 (tesA)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PA14_27160 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PA14_27160 (tesA)
Lipid biosynthesis proteins [BR:pau01004]
 Fatty acid synthase
  Component type
   PA14_27160 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2360105..2360710
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLASMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSKVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
cagggctgggtcgccctgttgcagaagcgcctcgccgacgaaggttacgactaccgggtg
gtgaacgcctcgatcagcggcgacacctccgcgggcggcctggcgcgcctgccggcgctg
cttgccgaggagaagccggcgctggtggtgatcgagctgggaggcaacgacgggctgcgc
ggaatggcgccggcgcaattgcaacagaatcttgccagcatggcgcaaaaggcccgggcg
gaaggggcgaaggtgctgctgctgggtatccagttgccgccgaactacggcccgcgctac
atcgaggccttttccaaggtctacggcgcggtcgcggcgcaggaaaagaccgccctggtg
ccgtttttcctcgaaggggtcggcggggtccaggggatgatgcaggcggatggcatccat
ccggcgctcgccgcccagccgaggctcctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system