KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_27500Help
Entry
PA14_27500        CDS       T00401                                 

Gene name
yfbQ
Definition
aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PA14_27500 (yfbQ)
   01230 Biosynthesis of amino acids
    PA14_27500 (yfbQ)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA14_27500 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    PA14_27500 (yfbQ)
Enzymes [BR:pau01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PA14_27500 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     PA14_27500 (yfbQ)
Amino acid related enzymes [BR:pau01007]
 Aminotransferase (transaminase)
  Class I
   PA14_27500 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2387034..2388245)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaatcctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggtctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggagggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgcggtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctcgaagacatc
aaggcgaagatcacgccgaacaccagggcgatggtgatcatcaacccgaacaaccccacc
ggtgcggtgtattccagggaagtgctggaaggcatggtcgagctggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccggacccaagcagcgggca
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagttgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgacccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgatgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system