KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_27520Help
Entry
PA14_27520        CDS       T00401                                 

Gene name
gpo
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PA14_27520 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PA14_27520 (gpo)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PA14_27520 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2388940..2389425
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISQFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRALGLLG
SQGIKWNFTKFLIGRDGQVVKRYAPTTKPEELSSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattctctgctgagcattccctgcaccaccatcaagggcgaacagaagaccctg
gccgatttcggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccaggggctggaggccttgtgggaaaaataccgtgagcgcggactggtggtg
ctcggcttcccctgcaaccagttcggcaagcaggaaccgggcgacgagggcgagatttcg
cagttctgcgagctgaactacggggtgagcttcccgctgttcaggaagatcgaggtcaac
ggcgccggcgcccacccgttgttcgtcagcctgaagaagcgcgcgctgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccaggtggtg
aagcgctacgcgccgaccaccaagccggaggagctgagttcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system