KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_31500Help
Entry
PA14_31500        CDS       T00401                                 

Definition
(GenBank) putative acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00010  Glycolysis / Gluconeogenesis
pau00620  Pyruvate metabolism
pau00640  Propanoate metabolism
pau00680  Methane metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PA14_31500
   00620 Pyruvate metabolism
    PA14_31500
   00640 Propanoate metabolism
    PA14_31500
  Energy metabolism
   00680 Methane metabolism
    PA14_31500
Enzymes [BR:pau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PA14_31500
Lipid biosynthesis proteins [BR:pau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PA14_31500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABJ11735
UniProt: A0A0H2ZBV3
Position
2738366..2740033
Genome map
AA seq 555 aa AA seqDB search
MRDYATTAAGFDLQRTAAATLSGTLQALNACVECCDRHALPGRIALFWEGKDGSRASYTF
SELKALSGRFANFLQAQGVRPGDCVAGLLPRTPELLVTILGAWRLGAVYQPLFTAFGPKA
IEHRVATAGSKVLVTDAANRDKLDELADPPLAVTVGGPKGQGIRRGDFSFWAELERYPAE
FEPVPRSGEDPFLMMFTSGTTGLAKPVPVPLKAILAFVGYLREAVDLRPEDAFWNLADPG
WAYGLYYAVAGPLAMGHPTTFYEGPFSVESTCRIIRDYGITNLAGSPTAYRLLMAAGAAA
ETALKGRLRAVSSAGEPLTPEVIRWFADRLGTTIHDHYGQTELGMVLCNHHALAHPVRVG
AAGFACPGHRVVVLDDDLNELPPGQPGILALDRRRSPLMWFPGYQGLETAAFVGDYYLSG
DTVELNEDGSISFVGRADDVITTSGYRVGPFDVESALIEHPAVMEAAVIGKPDPERTELV
KAFVVLCAGHRPTPELADELQRYVRQRLSAHAYPREIEFLEELPKTPSGKIQRFLLRNQE
IARQREAAPRAAAAN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgccaccactgccgccgggttcgacttgcagcggaccgccgccgccacg
ctttccggcacgctccaggcgctcaacgcctgcgtcgaatgctgcgaccggcatgccctg
ccgggtcggatcgcgttgttctgggagggcaaggatggcagtcgcgccagctataccttc
agcgagctgaaagcgctctccggacgtttcgccaatttcctccaggcccagggcgtacgc
ccgggcgattgcgtcgccggcctgttgccgcgcacgcccgagctgctggtcaccatcctc
ggcgcctggcgcctgggcgcggtgtaccagccgctgttcaccgccttcggcccgaaggcc
atcgaacaccgcgtggcgaccgccggcagcaaggtgctggtcaccgatgcggccaaccgc
gacaagctcgacgaactcgccgatccgcctctggccgtcaccgtcggcggaccgaagggg
cagggcatccgtcgcggcgatttcagcttctgggccgagctggagcgctatccggccgaa
ttcgagccggttccgcgcagcggcgaggatccgttcctgatgatgttcacctccggcacc
accggcctggccaaaccggtgccggtgccgctcaaggcgatcctcgccttcgtcggctac
ctgcgcgaggcggtggacctgcgccccgaggacgccttctggaacctcgccgatccgggc
tgggcctacggcctctactacgctgtcgccggtcccctcgccatgggccatccgaccacc
ttctacgaagggccgttcagcgtggaaagcacctgccggatcatccgtgactacggcatc
accaacctcgccggatcgcccaccgcctatcgcctgctgatggccgccggcgcggccgcg
gaaactgcgctgaaggggcgcctgcgcgcggtcagcagcgccggcgagccgttgacgccg
gaggtgatccgctggttcgccgacaggctcggcaccaccatccacgaccattacgggcag
accgagctgggcatggtgctgtgcaaccaccatgccctggcgcatccggtgcgggtcggc
gccgccggattcgcctgtcccgggcaccgggtggtagtgctggacgacgatctcaacgaa
ctgccgcccggccagccgggcatcctcgccctcgaccggcggcgttcgccgctgatgtgg
ttccccggctaccagggcctggaaaccgcagccttcgtcggcgactactacctgagcggc
gataccgtcgaactcaacgaagacggcagcatcagcttcgtcggccgcgccgacgacgtc
attaccacctctggctaccgggtcggcccgttcgatgtggagagcgcgctgatcgaacac
ccggcagtgatggaggcggcggtgatcggcaagcccgacccggagcgcaccgaactggtc
aaggccttcgtcgtgctctgcgccggccaccggccgacgccggaactggcggacgaactg
cagcgatacgtgcgccagcgcctgtcggcgcacgcctacccgcgggagatcgagttcctc
gaggaactgccgaagacccccagcggcaagatccagcgctttctcctgcgcaaccaggag
atcgcccggcaacgcgaggcggccccacgggcggccgccgcgaactga

DBGET integrated database retrieval system