KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_36590Help
Entry
PA14_36590        CDS       T00401                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PA14_36590 (malQ)
Enzymes [BR:pau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PA14_36590 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3256792..3258846
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRSQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRIALRLDAEGRLPAQARSGYAQ
LSLEQREWAVAMAPSSCPSLASLAPGRSRRWGLAAQVYALRRPGDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFIERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHAMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGQDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AADVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRDAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggtcgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgaactggtctacgaggacggcacgcggatc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagcggctatgcgcag
ctgtcgctggagcagcgggaatgggcggtggcgatggcgccgtcgagctgtccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctggggtctggccgcccaggtctatgccctg
cgccgccccggcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcatggcgccgacgcgctggcgatcagcccgctgcacgccctggccgaggcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccagcgaccattctcggcgcggcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccaactccaccgcgacttcatcgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggcgctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggcgacgctggccggag
ccgctgcgccgccccggcgaaccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgcgccttcggccagtggctgacccaacgctgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgac
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgatcatgcgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcagcgcgagctgctgcgc
ctgctggcgctggaggccagccgcgcctcggcgctggtcatcggcgaggacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacgccgccaggtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccaggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgacgtgccgctggacgcctgcatcggctatgtcggggcaacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccgggatgccgaggag
gccgcccatgattga

DBGET integrated database retrieval system