KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_37560Help
Entry
PA14_37560        CDS       T00401                                 

Gene name
asnB
Definition
asparagine synthetase, glutamine-hydrolysing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA14_37560 (asnB)
Enzymes [BR:pau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PA14_37560 (asnB)
Peptidases [BR:pau01002]
 Cysteine Peptidases
  Family C44
   PA14_37560 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3341401..3343233)
Genome map
AA seq 610 aa AA seqDB search
MCGITGWTDWSRDLGEQRSILERMTRTLAPRGPDAEGLWLSRHALLGHRRLAIIDLENGA
QPMLAEAGGRVALTYSGEVYNFRELRAELETLGQVFRTRSDTEVVLRAYLQWGEASFARL
RGIYGFALWDEREQSLWLVRDRFGVKPLYYYPTAGGVLFASEPKAIFANPEANPVLDASG
IAELFALTTAPTPGHGLYKGLRQVRPGQALRFDRNGVRELVYWALRAERHEEGAEDSAER
AGQLLREAVAEQLVADVPLGSLLSGGLDSSAISAFAVAALDGDARRLPTFSVDFPGEGRG
FVPTPWQSSWDEPYAQLAANFLGTPHRTVLVAPEEVLEQDEAVLQARDLPGWGELDASLY
LLFRQVREHTTVALSGESADEVFGGYPFFHDPSALAHDGFPWLAGKSGPWQLLRREVAER
VAAPEYIRARYREALAEVPRLDGEDAAQRRQREVAYLALSRWLPAMLERKDRMSMAVGLE
VRVPFCDHRLVEYVWNLPWALKSVAGESKSLLRRALRGHLPQAILERRKSGFPANPDPRY
LALLRERVGRLLADGRSPLFELVDAGRVRQALEQGTPLPSPRASASPTAGLAYLLNLDRW
LTRHGVDISL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcaccggctggaccgactggagccgcgacctcggcgagcagcgcagcatc
ctcgaacgcatgacccgtaccctggccccgcgcgggccggacgccgaaggcctgtggctg
tcgcggcacgcgctgctcggccatcggcgcctggcgatcatcgacctggagaacggcgcc
caaccgatgcttgccgaggcgggcgggcgggtggcgctgacctacagcggcgaggtctac
aacttccgcgagctgcgcgccgagctggagacgctgggccaggtcttccgtacccgctcg
gacaccgaggtggtgctgcgcgcctatctgcaatggggcgaggcttccttcgcccggctc
cgcggcatctacggcttcgccctgtgggacgagcgcgagcagagcctgtggctggtgcgc
gatcgcttcggggtcaagccgctgtactactacccgaccgccggaggcgtgctgttcgcc
tcggaacccaaggcgatcttcgccaaccccgaggccaacccggtgctcgacgccagcggc
atcgccgagctgttcgccctgaccaccgcgccgactcccggccacggcctgtacaagggc
ctgcgccaggtccggccgggccaggcgctgcgcttcgaccgcaatggtgtgcgcgagctg
gtctactgggcgctgcgcgcggaacgtcacgaagagggcgccgaggacagcgccgaacgc
gccggccagttgctccgcgaggcagtggccgagcagctggtggccgacgtcccgctgggc
agcctgctttccggcgggctcgactccagcgccatcagcgccttcgcggtggccgcgctg
gatggcgacgcgcggcgcctgccgaccttctccgtggacttccccggcgaaggccgcggc
ttcgtcccgacgccctggcaaagcagctgggacgaaccctatgcgcagctggcggcgaac
ttcctcggtacgccgcaccgtaccgtgctggtcgccccggaagaggtgctggaacaggac
gaggcggtgctccaggcccgcgacctgcccggctggggcgagctggacgcctcgctctac
ctgctgttccgccaggtccgcgagcacaccacggtggcgctgtcgggcgagtcggccgac
gaggtgttcggcggctacccgttcttccacgacccgagcgccctcgcacacgacggcttc
ccctggctggccggcaagagcgggccctggcaactgctgcggcgggaggtcgccgaacgg
gtggcggcgccggaatacatccgggcgcgctaccgcgaggccctcgccgaagtgccgcga
ctggatggcgaggatgccgcccagcggcgccagcgcgaggtcgcctacctggcgctgagc
cgctggttgccggcgatgctcgaacgcaaggaccggatgagcatggcggtcggcctggaa
gtgcgcgtgccgttctgcgaccaccgcctggtggagtacgtatggaacctgccctgggcg
ctgaagagcgtcgccggggaaagcaagagcctgctgcgccgggccctgcgcgggcacctg
ccgcaggcgatcctggagcggcgcaagagcggtttcccggccaaccccgacccacgttac
ctggcgctgctgcgcgagcgggtcggccgcctgctcgccgacggccgctcgccgctgttc
gaactggtggacgccgggcgggtccgccaggctctcgaacagggcacgccgctgcccagc
ccgcgtgcctcggcgagcccgaccgccggcctggcctacctgctgaacctggaccgctgg
ctgacccgccatggggtcgacatcagcctctga

DBGET integrated database retrieval system