KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_42080Help
Entry
PA14_42080        CDS       T00401                                 

Gene name
fadB
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00071  Fatty acid degradation
pau00280  Valine, leucine and isoleucine degradation
pau00281  Geraniol degradation
pau00310  Lysine degradation
pau00362  Benzoate degradation
pau00380  Tryptophan metabolism
pau00410  beta-Alanine metabolism
pau00640  Propanoate metabolism
pau00650  Butanoate metabolism
pau00903  Limonene and pinene degradation
pau00930  Caprolactam degradation
pau01040  Biosynthesis of unsaturated fatty acids
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
pau01212  Fatty acid metabolism
Module
pau_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PA14_42080 (fadB)
   00650 Butanoate metabolism
    PA14_42080 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PA14_42080 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PA14_42080 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PA14_42080 (fadB)
   00310 Lysine degradation
    PA14_42080 (fadB)
   00380 Tryptophan metabolism
    PA14_42080 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PA14_42080 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PA14_42080 (fadB)
   00281 Geraniol degradation
    PA14_42080 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PA14_42080 (fadB)
   00930 Caprolactam degradation
    PA14_42080 (fadB)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PA14_42080 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PA14_42080 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PA14_42080 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABJ10923
UniProt: A0A0H2Z9J2
Position
complement(3752461..3754605)
Genome map
AA seq 714 aa AA seqDB search
MTDAIRYEKGQDNVVVLTMDMPGQSANTMNGVYREAMAKTIARLEAEKEGIAGVVLTSAK
KTFFAGGDLNELIKVTKADAPAFYQGILELKGQLRRLETLGKPVVAAINGAALGGGWEIC
LACHHRIALDNPGVQLGLPEVTLGLLPGGGGVVRMVRLLGLEKALPYLAEGKKVRPAEAL
KAGLIHELADSPEEMLEKARAWILANPAAKQPWDSAGYKIPGGTPASPNVAQMLAIAPSV
LRDKTKGCFPAPEKIMCAAVEGAQVDFDTAQLIEARYFTELTTGQVAKNMIGTFWFQLNE
INAGKSRPQGYPVRATKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSLEAAEKGKAYSA
RLLDKKVARGHLSAEKRDAFLARIVPSVSEADFEGCDLIIEAVFEDRALKGKVTAEAEKH
ALADAVVASNTSTLPITGLAQAVARPEKFIGLHFFSPVDKMPLVEIIRGEKTSDETLARG
FDYVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVSAAMIDNQARQAGMPVGPL
AISDEVSLSLMTHIRNQTARDLEAEGKALPTHPAFAVIDLMVNEYKRPGKAAGAGFYDYP
ANGRKHLWAELKSRFEKPDAQISAEDVRDRLLFIQAIETVRCVEEGVLHSTADANIGSIF
GIGFAAWSGGALQFINQYGLKDFIARAQYLVEQYGERFEPPALLLEKAAKGELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgctatccgttacgaaaaaggccaggacaacgtcgtcgtcctgaccatggac
atgcccgggcagagcgccaacaccatgaacggtgtctaccgcgaggcgatggcgaagacc
atcgcgcggctggaggcggagaaagaggggatcgccggcgtggtgctgacctcggcgaag
aagaccttcttcgccggcggcgatctcaacgagctgatcaaggtcaccaaggccgacgcc
ccggccttctaccagggcatcctcgaactcaagggccaactgcggcgcctggagaccctc
ggcaagccggtggtcgccgcgatcaacggcgctgcgctgggcggcggctgggagatctgc
ctggcctgccaccaccgcatcgccctggacaatcccggcgtgcagctcggcctgccggag
gtgactctcggcctgttgccgggcggcggcggggtggtacgtatggtgcgcctgcttggt
ctggagaaagccctgccgtacctcgccgaaggcaagaaggtgcgtccggcggaagcgctc
aaggccgggctgatccacgaactggccgacagccccgaggaaatgctggagaaggcccgc
gcctggatcctcgccaacccggcggcgaagcagccctgggacagcgccggctacaagatt
cccggcggtacgcctgccagtcccaacgtggcgcagatgctggccatcgcaccgtcggtg
ctgcgcgacaagaccaagggttgcttcccggcgcccgagaagatcatgtgcgcggcggtg
gagggcgcccaggtcgatttcgacaccgcgcaactgatcgaggcgcgctatttcaccgag
ctgaccaccggccaggtggcgaagaacatgatcggcaccttctggttccagctcaacgag
atcaacgccggcaagtcgcggccgcaggggtatccggtgcgggcgacgaaaaaggtcggc
gtgctcggcgccgggatgatgggcgcgggcatcgcctacgtatcggcggcggccggcatc
gaggtggtgctcaaggacgtctcgctggaagcggcggagaagggcaaggcctattcggcc
aggctgctggacaagaaagttgcgcgcgggcacctgtccgccgagaagcgcgacgccttc
ctcgcgcggatcgtgccgagcgtcagcgaagccgatttcgaaggctgcgacctgatcatc
gaggcggtcttcgaggaccgcgcgctgaaaggcaaggtcaccgccgaggccgagaagcat
gccctggccgatgcggtggtggcgtccaatacctcgaccctgccgatcaccgggctggcc
caggcggtggcgcggccggagaagttcatcggcctgcacttcttcagcccggtggacaag
atgccgctggtggagatcatccgcggcgaaaagaccagcgacgaaaccctggcacgcggt
ttcgactacgtgctgcagatcaagaaaacgccgatcgtggtcaacgacagccgcggcttc
ttcacctcgcgggtattcggcaccttcaccaacgaaggcatcgccatgctcggcgaaggc
gtgagcgccgcgatgatcgacaaccaggcgcgccaggccggtatgccggtggggccgctg
gcgatttccgacgaagtctcgctgagcctgatgacccacatccgcaaccagaccgcccgc
gacctcgaggccgagggcaaggctctgccgacgcaccccgcgttcgccgtgatcgacctg
atggtcaatgagtacaagcgcccgggcaaggcggccggcgccggcttctacgactacccg
gcgaacggcaggaaacatctctgggcggaactcaagagccgcttcgagaagcccgatgcg
caaatatccgccgaggacgtacgcgaccgcctgctgttcatccaggccatcgagaccgtt
cgttgcgtggaggagggggtattgcactccaccgccgacgcgaacatcggctcgatcttc
ggtatcggtttcgccgcctggagcgggggcgccttgcagttcatcaaccagtacggcctg
aaggacttcatcgcccgcgcccaatacctggtcgaacagtacggcgagcgcttcgagccg
ccggcgctgttgctggagaaggcggcgaagggcgagctgttctga

DBGET integrated database retrieval system