KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_43320Help
Entry
PA14_43320        CDS       T00401                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA14_43320 (glsA)
   00330 Arginine and proline metabolism
    PA14_43320 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PA14_43320 (glsA)
Enzymes [BR:pau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PA14_43320 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3858484..3859392)
Genome map
AA seq 302 aa AA seqDB search
MQQLLNEILDEVRPLIGRGKVADYIPALAGVEPNQLGIAVYSRDGELFHAGDALRPFSIQ
SISKVFSLVQAIQHSGEDIWQRLGHEPSGQPFNSLVQLEFERGKPRNPFINAGALVICDI
NQSRFAAPAQSMRDFVRRLCGNPEVVSDSVVARSEYQHRSRNAAAAYLMKSFGNFHNDVE
AVLLSYFHHCALRMSCVDLARAFCFLADKGFCKHSGEQVLNERQTKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAVVPGRFTVCVWSPELNAAGNSLAGIAALEKLSERIGWS
IF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaactgttgaacgagattctcgatgaagtccgcccgctgatcgggcgcggcaag
gtcgccgactacattcccgcgctcgccggcgtcgagccgaaccaactggggatcgccgtg
tacagccgcgacggcgagctgttccatgccggcgacgccctgcggccgttttccatccag
agcatttccaaggtgttcagcctggtccaggcgatccagcattccggcgaggacatctgg
caacgcctcggccacgagccctccggccagcctttcaactccctggtgcagctggagttc
gagcgcggcaagccgcgcaatccgttcatcaatgccggcgccctggtgatctgcgacatc
aaccagtcgcgtttcgccgcgccggcgcaatcgatgcgcgatttcgtccggcgcctgtgc
ggcaacccggaagtggtgtcggactcggtggtggcgcgctcggagtaccagcaccgctcg
cgcaacgcggcggcggcctacctgatgaaatcgttcggcaacttccacaacgacgtcgag
gcggtgctgctcagctatttccatcattgcgcgttgcgcatgagctgcgtcgacctggcg
cgggcgttctgcttcctcgccgacaagggcttctgcaagcacagcggcgagcaggtgctc
aacgagcggcagaccaagcaggtcaacgcgatcatggccaccagcgggctctacgacgag
gccggcaactttgcctaccgggtcggcctgccgggcaagagcggcgtcggcggcggcatc
atcgcggtggtgccggggcgcttcacggtctgcgtctggtcgccggagctgaacgccgcg
ggcaattcgctggcgggtatcgccgcgctggaaaagctcagcgagcggatcggctggtcg
atcttctga

DBGET integrated database retrieval system