KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_44050Help
Entry
PA14_44050        CDS       T00401                                 

Gene name
sdhD
Definition
succinate dehydrogenase (D subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PA14_44050 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA14_44050 (sdhD)
   00650 Butanoate metabolism
    PA14_44050 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PA14_44050 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922017..3922385)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIF
SLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGVQILW
GM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacaaacttctcgcgctccggcctctacgactggatggcccagcgc
gtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcattgctcac
cccaacatttcctacgcggactggcacggcctgttctcgcagggttggatgcgcatcttc
agcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggaccatctcc
accgactacctgacttcgatggctctcggcaaggcggcgacagtcgtgcgtttcctcttc
caggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtgcagattctttgg
ggtatgtga

DBGET integrated database retrieval system