KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_44050Help
Entry
PA14_44050        CDS       T00401                                 

Gene name
sdhD
Definition
succinate dehydrogenase (D subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pau01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pau00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pau00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pau00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922017..3922385)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIF
SLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGVQILW
GM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacaaacttctcgcgctccggcctctacgactggatggcccagcgc
gtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcattgctcac
cccaacatttcctacgcggactggcacggcctgttctcgcagggttggatgcgcatcttc
agcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggaccatctcc
accgactacctgacttcgatggctctcggcaaggcggcgacagtcgtgcgtttcctcttc
caggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtgcagattctttgg
ggtatgtga

DBGET integrated database retrieval system