KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_44050Help
Entry
PA14_44050        CDS       T00401                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (D subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00020  Citrate cycle (TCA cycle)
pau00190  Oxidative phosphorylation
pau00650  Butanoate metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01200  Carbon metabolism
Module
pau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PA14_44050 (sdhD)
   00650 Butanoate metabolism
    PA14_44050 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PA14_44050 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ABJ10763
UniProt: A0A0H2Z9F0
Position
complement(3922017..3922385)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIF
SLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGVQILW
GM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacaaacttctcgcgctccggcctctacgactggatggcccagcgc
gtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcattgctcac
cccaacatttcctacgcggactggcacggcctgttctcgcagggttggatgcgcatcttc
agcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggaccatctcc
accgactacctgacttcgatggctctcggcaaggcggcgacagtcgtgcgtttcctcttc
caggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtgcagattctttgg
ggtatgtga

DBGET integrated database retrieval system