KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_45190Help
Entry
PA14_45190        CDS       T00401                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PA14_45190
Enzymes [BR:pau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PA14_45190
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PA14_45190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4030165..4031580
Genome map
AA seq 471 aa AA seqDB search
MRIAALDQGTTSTRVLVASQDGSADIQLALRHQQHHPQSGWVEHDPLELLANLQRCLEAS
GRVDAIGLANQGESCMAWDARSGEPLSPLIVWQDNRTTPHIERLRASGAEALVLERSGLP
LDAYFSASKLGWIVEHLPAARRALEAGRLRLGTSDAWFLDRLCGTFATDVTTASRTALMN
LAEGRWDPELCALFGVPIECLPEIRDTVGHFGVIGNTPLTASVVDQQASLYGHGCRQPGD
AKITFGTGAFALTLSGERIIRSPETGLLATIAWQIDGKPVYAMDGGVYDASAAVEWAGRL
GLFSDFSELAGFDRPPAIDRGLAFVPALSGLACPHWDRSAGAMWLGMDAGTRREDLCQAL
LEGVVLRSAEVIQAMDGYLKVTDRLSIDGGLARSPYFAQFLADSLQRRIVTQRFDELTAF
GCAALAARGLGYELAEPRNTRTEFQPRVDAGTARRWQVRFSEAVARTRGWR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgccgccctcgaccagggaaccaccagtacccgcgtgctggtcgccagccag
gacggcagcgccgatattcagttggcgctgcgtcaccagcaacaccatccgcagtccggt
tgggtcgagcacgatccgctggaactgctggccaacctgcaacgctgcctggaggccagc
ggccgggtcgacgccatcggcctcgccaaccagggcgaaagctgcatggcctgggacgcc
cgcagcggcgagccgttgtcgccgctgatcgtctggcaggacaaccgcaccaccccgcac
atcgagcgtctacgcgccagcggcgccgaggcgctggtcctggaacgcagcggcctgccg
ctcgatgcctatttctcggccagcaagctgggctggatcgtcgagcaccttcctgccgct
cgccgggctctcgaggccggccgcctgcgcctgggaaccagcgacgcctggtttctcgac
cgcttgtgcggaaccttcgccaccgacgtcaccaccgcctcgcgcaccgcattgatgaac
ctcgccgagggccgctgggaccccgaactgtgcgccctgttcggcgtgccgatcgagtgc
ctgccggaaatccgcgataccgtcggccatttcggggtgatcggcaacactccgctgacg
gcctcggtggttgaccagcaggcctcgctctacggtcacggctgccgccagcccggtgat
gcgaagatcaccttcggcaccggcgccttcgccctgacccttagcggcgagcggatcatc
cgctcgccggagacaggcctgctcgccaccatcgcctggcagatcgatggcaagccggtg
tacgccatggacggcggggtctacgatgccagcgccgcagtcgagtgggccgggcgtctt
ggcctgttcagcgacttctcggaactggccggcttcgaccggccgccggccatcgaccgc
gggctggccttcgtcccggccttgtcgggactcgcatgcccgcactgggaccgcagcgcc
ggcgcgatgtggctgggaatggacgccggcacccgccgcgaggacctctgccaggccctg
ctcgaaggcgtggtgctgcgcagcgccgaggtgatccaggcgatggacggctacctgaag
gtcaccgaccgcctgtccatcgacggcggcctggcgcgcagcccctacttcgcccagttc
ctcgccgacagcctgcaacggcgcatcgtcacccagcgcttcgacgaactcaccgccttc
ggttgcgccgcccttgccgcgcggggcctcggctacgagctggcggagccgcgcaacacc
cgcacggagttccagccgcgggtcgacgccggcaccgcccggcgctggcaggtgcgtttc
agcgaagcggtggcgcgcacccgcggctggcgctga

DBGET integrated database retrieval system