KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_52180Help
Entry
PA14_52180        CDS       T00401                                 

Gene name
relA
Definition
GTP pyrophosphokinase
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pau00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4626261..4628504)
Genome map
AA seq 747 aa AA seqDB search
MVQVRAHQPVNTDGSINLEAWLDHVQNLVPGLDRQGLLEACEFARESEQRAIAAQNSWAE
GTSSFQTGLEIAEILADLKLDQESLVAAVIYRGVREGKITLEAVNKHFGPVVAKLIEGVL
RMAAISASLNPRHSMVLGTQAQVENLRKMLVAMVDDVRVALIKLAERTCAIRAVKNADEE
KRHRVAREVFDIYAPLAHRLGIGHIKWELEDLSFRYLEPDQYKQIAKLLHERRLDREQYI
ANVMSQLKEALAATGVQADLSGRAKHIYSIWRKMQRKGLDFSQIYDVRAVRVLVPEMRDC
YTALGIVHTLWRHIPKEFDDYIANPKENGYRSLHTAVIGPEGKVLEVQIRTHSMHEEAEL
GVCAHWRYKGTDVKASSNHYEEKISWLRQVLEWHEELGDIGGLAEQLRVDIEPDRVYVFT
PDGHAIDLPKGATPLDFAYRVHTEVGHNCRGAKINGRIVPLNYSLQTGEQVEIITGKHSG
PSRDWLNSNLGYVTTSRARAKIVHWFKLQARDQNVAAGKALIERELSRLALPPVDFDRLA
EKANVRTAEDMFAALGAGDLRLAHLVNYAQQLVEPDRDSEQLELIPRKPSKIGHGKRGDV
QIQGVGNLLTQMAGCCQPLPGDPIVGYITLGRGVTIHRQDCATALQLAGREPERMIQVSW
GPEPVRTYPVDIAIRAYDRSGLLRDVSQVLLNERINVLAVNTRSNKEDNTATMQLTIEIP
GLDALGRLLARVSQLPNIIEARRNRTP
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggtgagagcgcaccagccggtcaacaccgacggcagtatcaacctcgaggcc
tggctggaccacgtccagaacctcgtccccgggctcgatcgtcagggcttgctggaggct
tgcgagttcgctcgcgaatccgagcagcgagcgatcgccgcacagaactcctgggcagaa
ggcacgtccagcttccagaccggactggaaatcgccgagatcctcgcggacctcaagctg
gatcaggagtccctggtcgccgcggtcatctatcgaggcgtgcgggaaggcaagatcacc
ctggaagcggtcaacaagcatttcgggccggtggtggccaagctgatcgagggcgtgctg
cgcatggccgcaatcagcgccagcctcaatccgcgccattccatggtgctgggtacccag
gcgcaggtggagaacctgcgcaagatgctggtggcgatggtcgacgacgttcgcgtcgct
ctgatcaagctggccgagcgcacctgcgccattcgcgcggtgaagaatgccgacgaggaa
aagcgccaccgcgtcgcccgggaagtcttcgatatctacgcgccgctggcccaccgcctg
ggcatcgggcatatcaagtgggagctggaggacctgtccttccgttacctcgagcccgac
cagtacaagcagatcgccaagctgctgcacgagcgccggctggatcgcgagcagtacatc
gccaacgtgatgagccagttgaaggaagctctcgcggccaccggcgtacaggccgatctc
agcgggcgggcgaaacacatctattcgatctggcgcaagatgcagcgcaagggcctggac
ttcagccagatctacgacgttcgcgccgtgcgcgtgctcgttccggagatgcgcgactgc
tacaccgcgctgggcatcgtgcataccctctggcggcacattcccaaggagttcgacgac
tacatcgccaaccccaaggaaaacggctatcgctcgctgcataccgcagtgatcggcccc
gaggggaaggtgctggaagtacagatccgtacccactccatgcacgaagaggcggagctc
ggggtctgcgcgcactggcgctacaaggggaccgacgtcaaggccagctccaaccattac
gaggaaaagatctcctggctgcgccaggtgctcgaatggcacgaggaactgggcgacatc
ggtggcctggcggagcaactgcgggtcgatatcgagccggacagggtctacgtcttcact
cccgacggccacgccatcgacctgcccaagggcgcgaccccgctggatttcgcctatcgg
gtccacactgaagtcgggcacaactgccgcggggcgaagatcaacggacgcatcgtgccg
ctgaactacagcctgcagaccggcgagcaggtcgagatcatcaccggcaagcacagcggt
ccgagccgtgactggctgaacagcaacctgggctatgtcaccacctcccgggcgcgggcg
aagatcgtccactggttcaagctgcaggcgcgggaccagaacgtcgctgccggcaaggcc
ctgatcgaacgcgagctgtcgcgcctggcgctgccgccggtggatttcgaccggctggcg
gagaaggccaacgtgcgtaccgccgaggatatgttcgccgctctcggcgccggcgacctg
cgcttggcgcacctggtcaactatgcccagcaactggtcgagccggaccgcgacagcgag
caactcgaactgatcccgcgcaagccgagcaagatcggccacggcaagcgcggcgacgtg
cagatccagggcgtcggcaacctcctgacgcagatggccggctgctgccagccgctgccg
ggagatcccatcgtcggctacatcacgctgggccgtggggtcaccatccaccgccaggat
tgcgccaccgcgctgcaactggcgggacgcgaaccggagcggatgatccaggtcagttgg
gggccggagccggttcgcacctatccggtggatatcgcgatccgtgcctatgatcgttcc
ggcctgttgcgcgacgtgtcccaggtgctgctcaatgagcggatcaacgttctggcggtg
aatacccgttcgaacaaggaagacaacaccgcgaccatgcaactgaccatcgagattccc
ggtctggacgctcttggacgcctgctggcgcgcgtttcgcaactgcccaacatcatcgag
gcgcggcgcaaccgtacgccttga

DBGET integrated database retrieval system