KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_52610Help
Entry
PA14_52610        CDS       T00401                                 

Definition
hypothetical protein
Orthology
K01620  
threonine aldolase [EC:4.1.2.5]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pau01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pau00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4664895..4665899)
Genome map
AA seq 334 aa AA seqDB search
MPVIDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLDLDKVAA
AIKADDFHFARTRLLALENTMQGKVLPLDYLAAARAFTRARGLALHLDGARLYNAAVKLG
VDASEITRHFDSVSVCLSKGLGAPVGSVLCGSVELIGKARRWRKMVGGGMRQAGLLAAAG
LYALDHQVARLADDHANAARLGDGLRELGYAVEPVQTNMVYVDVGERAVALRDFLAEREV
RISAAARLRLVTHLDVSAESIGQVLDAFAAFRRS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcatcgacctgcgcagcgacaccgtcacccagcccaccgccggcatgcgcgaa
gccatggccgcggccgaactgggcgacgacgtctatggcgaggaccccacggtcaaccgc
ctggaggccgaactggcggcgcgcctgggcttcgccgcggcgctcttcgtaccgaccggg
accatgagcaacctgctcggattgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcgcatacctacaaatacgagggcggcggtgccgcggtgctgggctcgatc
cagccgcagccgatcgacggcgaggccgacggatcgctcgacctggacaaggtcgcggcg
gcgatcaaggccgacgacttccatttcgccaggacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccgctcgactacctggccgcggcgcgcgccttcactcgcgcg
cgtggcctggccctgcacctggatggcgcgcgcctgtacaacgcggcggtgaagctgggc
gtagacgccagcgagatcacccggcacttcgactcggtgtcggtgtgcctgtccaagggc
ctcggtgcgccggtgggctcggtgctttgcggcagcgtcgaactgatcggcaaggcccgt
cgctggcgcaagatggtcggcggcgggatgcgccaggccggcctgctggcggctgccggc
ctgtacgccctcgaccaccaggtggcacgcctggccgacgaccacgccaacgccgcgcgc
ctgggcgacgggctgcgcgaactgggctatgcggtggagccggtgcagaccaacatggtc
tacgtcgatgtcggcgagcgggcggtcgcgctgcgcgacttcctcgccgagcgcgaggtg
cggatcagcgcggcggcgcgtttgcgcctggtcacccacctggacgtttccgccgagtcc
ataggacaagtactggatgccttcgcggcctttcgtcgctcataa

DBGET integrated database retrieval system