KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_52610Help
Entry
PA14_52610        CDS       T00401                                 

Definition
hypothetical protein
Orthology
K01620  
threonine aldolase [EC:4.1.2.5]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PA14_52610
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA14_52610
Enzymes [BR:pau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.5  L-threonine aldolase
     PA14_52610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4664895..4665899)
Genome map
AA seq 334 aa AA seqDB search
MPVIDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLDLDKVAA
AIKADDFHFARTRLLALENTMQGKVLPLDYLAAARAFTRARGLALHLDGARLYNAAVKLG
VDASEITRHFDSVSVCLSKGLGAPVGSVLCGSVELIGKARRWRKMVGGGMRQAGLLAAAG
LYALDHQVARLADDHANAARLGDGLRELGYAVEPVQTNMVYVDVGERAVALRDFLAEREV
RISAAARLRLVTHLDVSAESIGQVLDAFAAFRRS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcatcgacctgcgcagcgacaccgtcacccagcccaccgccggcatgcgcgaa
gccatggccgcggccgaactgggcgacgacgtctatggcgaggaccccacggtcaaccgc
ctggaggccgaactggcggcgcgcctgggcttcgccgcggcgctcttcgtaccgaccggg
accatgagcaacctgctcggattgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcgcatacctacaaatacgagggcggcggtgccgcggtgctgggctcgatc
cagccgcagccgatcgacggcgaggccgacggatcgctcgacctggacaaggtcgcggcg
gcgatcaaggccgacgacttccatttcgccaggacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccgctcgactacctggccgcggcgcgcgccttcactcgcgcg
cgtggcctggccctgcacctggatggcgcgcgcctgtacaacgcggcggtgaagctgggc
gtagacgccagcgagatcacccggcacttcgactcggtgtcggtgtgcctgtccaagggc
ctcggtgcgccggtgggctcggtgctttgcggcagcgtcgaactgatcggcaaggcccgt
cgctggcgcaagatggtcggcggcgggatgcgccaggccggcctgctggcggctgccggc
ctgtacgccctcgaccaccaggtggcacgcctggccgacgaccacgccaacgccgcgcgc
ctgggcgacgggctgcgcgaactgggctatgcggtggagccggtgcagaccaacatggtc
tacgtcgatgtcggcgagcgggcggtcgcgctgcgcgacttcctcgccgagcgcgaggtg
cggatcagcgcggcggcgcgtttgcgcctggtcacccacctggacgtttccgccgagtcc
ataggacaagtactggatgccttcgcggcctttcgtcgctcataa

DBGET integrated database retrieval system