KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_52610Help
Entry
PA14_52610        CDS       T00401                                 

Definition
(GenBank) possible threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
pau00260  Glycine, serine and threonine metabolism
pau01100  Metabolic pathways
pau01110  Biosynthesis of secondary metabolites
pau01120  Microbial metabolism in diverse environments
pau01130  Biosynthesis of antibiotics
pau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PA14_52610
Enzymes [BR:pau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PA14_52610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABJ10062
UniProt: A0A0H2Z7M2
Position
complement(4664895..4665899)
Genome map
AA seq 334 aa AA seqDB search
MPVIDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLDLDKVAA
AIKADDFHFARTRLLALENTMQGKVLPLDYLAAARAFTRARGLALHLDGARLYNAAVKLG
VDASEITRHFDSVSVCLSKGLGAPVGSVLCGSVELIGKARRWRKMVGGGMRQAGLLAAAG
LYALDHQVARLADDHANAARLGDGLRELGYAVEPVQTNMVYVDVGERAVALRDFLAEREV
RISAAARLRLVTHLDVSAESIGQVLDAFAAFRRS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcatcgacctgcgcagcgacaccgtcacccagcccaccgccggcatgcgcgaa
gccatggccgcggccgaactgggcgacgacgtctatggcgaggaccccacggtcaaccgc
ctggaggccgaactggcggcgcgcctgggcttcgccgcggcgctcttcgtaccgaccggg
accatgagcaacctgctcggattgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcgcatacctacaaatacgagggcggcggtgccgcggtgctgggctcgatc
cagccgcagccgatcgacggcgaggccgacggatcgctcgacctggacaaggtcgcggcg
gcgatcaaggccgacgacttccatttcgccaggacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccgctcgactacctggccgcggcgcgcgccttcactcgcgcg
cgtggcctggccctgcacctggatggcgcgcgcctgtacaacgcggcggtgaagctgggc
gtagacgccagcgagatcacccggcacttcgactcggtgtcggtgtgcctgtccaagggc
ctcggtgcgccggtgggctcggtgctttgcggcagcgtcgaactgatcggcaaggcccgt
cgctggcgcaagatggtcggcggcgggatgcgccaggccggcctgctggcggctgccggc
ctgtacgccctcgaccaccaggtggcacgcctggccgacgaccacgccaacgccgcgcgc
ctgggcgacgggctgcgcgaactgggctatgcggtggagccggtgcagaccaacatggtc
tacgtcgatgtcggcgagcgggcggtcgcgctgcgcgacttcctcgccgagcgcgaggtg
cggatcagcgcggcggcgcgtttgcgcctggtcacccacctggacgtttccgccgagtcc
ataggacaagtactggatgccttcgcggcctttcgtcgctcataa

DBGET integrated database retrieval system