KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_56180Help
Entry
PA14_56180        CDS       T00401                                 

Definition
hypothetical protein
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5017092..5017451)
Genome map
AA seq 119 aa AA seqDB search
MGLQRHIQRHQLPSYLKVFNRITDKPMGYIGNVSEDGLLLISQLPMLVGARFELRLKVPG
LGGRPQCIDFSADCRWTCEDVTPGHFDSGFHLLAPPAEFLELVEALRRYFSFPRQPQSV
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttcaacgacatatccagcgccatcagttgcccagctacctgaaggtgttcaat
cgcatcaccgacaagccgatgggctacatcggcaacgtctccgaggacggcctgctgctg
atcagccaactgccgatgctggtcggcgcgcgtttcgaactgcgcctgaaggttccggga
ctgggcggtcgcccgcaatgcatcgatttttccgccgactgccggtggacctgcgaggac
gtcacgcccggtcatttcgattccggcttccacctgctggcgccgcccgccgaattcctc
gaactggtggaggcgctgcgccgctacttcagcttcccccgccagccgcagtcggtctga

DBGET integrated database retrieval system