KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_57780Help
Entry
PA14_57780        CDS       T00401                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PA14_57780 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    PA14_57780 (hisD)
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PA14_57780 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5145695..5147017)
Genome map
AA seq 440 aa AA seqDB search
MTAPFAIRRLNAADPDFGRHLDHLLSWESVSDDSVNQRVLDIIAAVRSRGDAAVVEFTQR
FDGLQAASMADLILPRERLELALTRITVAQREALEVAAERVRSYHEKQKQGSWRYTEADG
TVLGQQVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVSEVVMVVPTPRGEINEIVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPRVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAAFLDRVADSIARLLPTMER
AEIIRTSLEGRGALIQVADQAQACAVANRIAPEHLELSVADPESWLPEIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIINCSAEGASVLGRTASVLARG
ESLTAHARSAEYRILDEKEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccttcgctatccgtcgactcaatgccgctgatccggacttcgggcgtcat
ctggatcatctgctgagctgggaaagtgtctccgacgattcggtcaaccagcgcgtcctc
gacatcatcgccgccgtacgcagccgtggcgacgccgccgtggtcgagttcacccagcgc
ttcgacggtctccaggccgcctcgatggctgacctgatcctgccgcgcgagcgcctggag
ctggctctcacccgtatcaccgtagcccagcgcgaagccctggaagtcgccgccgagcgc
gtgcgcagctaccacgagaagcagaagcagggttcctggcgctacaccgaggccgacggc
acggtgctcggccagcaggtcactcccctggatcgcgccgggctctatgtgccgggcggc
aaggcgtcctacccgtcctcggtgctgatgaacgcgatcccggccaaggtcgccggggtg
tccgaagtggtcatggtcgtaccgaccccgcgcggcgagatcaacgagatcgtcctcgcc
gccgcctgcatcgccggtgtcgaccgtgtcttcaccatcggcggggcacaggccgtggcc
gcgttggcctacggcaccgaaagcgtgccgcgggtggacaagatcgtcggccccggcaac
atctacgtggccaccgccaagcgtcacgtgttcggccaggtcggcatcgacatgatcgcc
ggtccctcggaaatcctcgtggtctgcgatggccagaccgatcccgactggatcgccatg
gacctgttctcccaggccgaacacgacgaagacgcccagtcgatcctggtcagtccggac
gcggcgttcctggaccgcgtcgcggacagcatcgctcgcctgctgccgaccatggagcgc
gccgagatcatccgcacctccctggaggggcgtggcgcgctgatccaggtcgccgaccag
gcccaggcctgcgcggtggccaaccgcatcgccccggaacacctggaactgtcggtggcc
gatccggaaagctggctgccggagatccgccatgccggtgcgatcttcatgggccgctac
actgccgaggccctgggcgactactgcgccggcccgaaccacgtgctgccgacctccggt
accgcgcgtttctcttcgccgctgggggtatatgacttccagaagcgttcgtcgatcatc
aactgctcggccgagggcgcttcggtcctcggtcgcaccgcttcggtgctggctcgcggc
gagtcgttgaccgcccacgcgcgcagcgccgaataccgcatcctcgacgagaaggaggcc
tga

DBGET integrated database retrieval system