KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_60700Help
Entry
PA14_60700        CDS       T00401                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PA14_60700 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5408784..5409824
Genome map
AA seq 346 aa AA seqDB search
MQSSQLLPLGSLLLSFATPLAQADALHDQASALFKPIPEQVTELRGQPISEQQRELGKKL
FFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGR
AKDLGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIE
AYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLV
KKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGN
AQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctcgcaactgctcccgcttggcagcctgttgctgtcgttcgccacgcccctc
gcccaggccgatgccctgcacgaccaggccagcgcgctgttcaaacccatccccgagcag
gtcaccgagctgcgcggccagcccatcagcgagcaacagcgcgaactcggcaagaaactg
ttcttcgacccgcgcctgtcgcgcagccatgtgctcagctgcaacacctgccacaacgtc
ggcaccggcggcgccgacaacgtaccgacgtcggtcggtcacggctggcagaaggggcca
cgcaattcgccgacggtcttcaacgccgtgttcaatgccgcgcagttctgggatggccgc
gccaaggacctgggggagcaggccaagggtccgatccagaacagcgtcgagatgcacagt
accccgcagttggtcgaacagaccctgggcagcatcccggaatacgtggacgccttccgc
aaggccttccccaaggccggcaagccggtcagcttcgacaacatggcgctggccatcgag
gcctacgaggcgaccctggtgactccggactcgcccttcgacctgtatctcaagggcgac
gacaaggccctcgacgcgcagcagaagaaaggcctcaaggcgttcatggacagtggctgc
agcgcctgccacaacggcatcaatctgggcggccaggcctacttcccgttcggcctggtg
aagaagcccgacgctagcgtcctgcccagcggcgacaagggccgcttcgccgtgaccaag
acccagagcgacgagtacgtattccgcgccgcgcccctgcgcaatgtcgccctcaccgcg
ccgtacttccacagcggccaggtctgggaactcaaggacgcggtggcgatcatgggcaac
gcccagctcggcaagcagttggcgccggacgacgtggagaacatcgtcgccttcctgcac
agcctgagcggcaagcagccgcgcgtcgaatatccgctgctgccggccagcacggagacc
acgccgcgtcccgcggaataa

DBGET integrated database retrieval system