KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_61280Help
Entry
PA14_61280        CDS       T00401                                 

Definition
epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
Enzymes [BR:pau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PA14_61280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(5470313..5471338)
Genome map
AA seq 341 aa AA seqDB search
MDEQPLSRPGAHVKYAVLGATGLLGHHAARAIRAAGHDLVLIHRPSSQIQRLAYLEPECR
VAEMLDHAGLERALRGLDGVIFSAGYYPSRPRRWQEEVASALGQTNPFYAACLQARVPRI
LYVGSAYAMPRHPQGLPGHEGLFYDSLPSGKSSYVLCKWALDEQAREQARNGLPVVIGIP
GMVLGELDIGPTTGRVITAIGNGEMTHYVAGQRNVIDAAEAGRGLLMALERGRIGERYLL
TGHNLEMADLTRRIAELLGQPAPQPMSMAMARALATLGRLRYRVSGQLPLLDETAIEVMA
GGQFLDGRKAREELGFFSTTALDDTLLRAIDWFRDNGYFNA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggacgaacagccactctcacgccctggagctcatgtgaaatacgccgtactcggagcc
accggcctgctgggacatcacgccgcgcgcgccatcagggccgccggtcacgatctggtg
ctgatccaccgtccttcttcgcagatccagcgtctcgcctatctggagcccgagtgccgg
gtcgccgagatgctcgaccacgccggcctggaacgcgccctgcgcggcctcgacggggtg
atcttcagcgccggctactatccttcgcggccgcgccgctggcaggaggaagtggccagc
gcgctgggccagaccaacccgttctatgccgcctgcctgcaggccagggtgccgcgcatc
ctctacgtcggttcggcatatgccatgccccggcatccccagggactaccggggcacgag
gggttgttctacgacagcctgccgagcggcaagagttcctacgtgctgtgcaaatgggcg
ctcgacgagcaggcccgggagcaggcgcgcaacggcctgccggtggtgatcgggatcccc
ggcatggtactcggcgaactggacatcggcccgaccaccggacgcgtgatcaccgccatc
ggcaatggcgagatgacccactacgtcgccggccagcgtaacgtcatcgatgccgccgaa
gccgggcgcggcctgctgatggcccttgagcgcgggcgtatcggcgagcgctacctgctg
accgggcacaacctggaaatggccgacctgacccggcgcatcgccgagctgctcggccag
cctgcgccgcagccgatgtcgatggccatggctcgcgcgctggccaccctgggccgcttg
cgctaccgggtcagcggccagttgccgctgctcgacgaaaccgccatcgaggtgatggct
ggcgggcagttcctcgatggacgcaaggcccgcgaggaactcggcttcttctccaccacc
gccctcgacgacaccctgctgcgcgccatcgactggttccgcgacaacggctatttcaat
gcctag

DBGET integrated database retrieval system